Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Mouse anti-Human SLC6A11 Monoclonal Antibody | anti-SLC6A11 antibody

SLC6A11 (GABT3, GAT3, Sodium- and Chloride-dependent GABA Transporter 3, Solute Carrier Family 6 Member 11, GAT-3)

Gene Names
SLC6A11; GAT3; GAT4; GAT-3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC6A11; Monoclonal Antibody; SLC6A11 (GABT3; GAT3; Sodium- and Chloride-dependent GABA Transporter 3; Solute Carrier Family 6 Member 11; GAT-3); Anti -SLC6A11 (GABT3; anti-SLC6A11 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2C3
Specificity
Recognizes human SLC6A11.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
TELPWATCGHEWNTENCVEFQKLNVSNYSHVSLQNATSPVMEFWEHRVLAISDGIEHIGNLR*
Applicable Applications for anti-SLC6A11 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa164-226 from human SLC6A11 (NP_055044) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.93kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.93kD).)

Testing Data

(Detection limit for recombinant GST tagged SLC6A11 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC6A11 is 0.1ng/ml as a capture antibody.)
Related Product Information for anti-SLC6A11 antibody
Gamma-aminobutyric acid (GABA) is a major inhibitory neurotransmitter. GABAergic neurotransmission is terminated by the uptake of GABA into the presynaptic terminal and the surrounding astroglial cells by sodium-dependent transporters, such as SLC6A11 (Borden et al., 1994 [PubMed 7874447]).
Product Categories/Family for anti-SLC6A11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
70,606 Da
NCBI Official Full Name
sodium- and chloride-dependent GABA transporter 3
NCBI Official Synonym Full Names
solute carrier family 6 (neurotransmitter transporter), member 11
NCBI Official Symbol
SLC6A11
NCBI Official Synonym Symbols
GAT3; GAT4; GAT-3
NCBI Protein Information
sodium- and chloride-dependent GABA transporter 3; solute carrier family 6 member 11; solute carrier family 6 (neurotransmitter transporter, GABA), member 11
UniProt Protein Name
Sodium- and chloride-dependent GABA transporter 3
UniProt Gene Name
SLC6A11
UniProt Synonym Gene Names
GABT3; GAT3; GAT-3
UniProt Entry Name
S6A11_HUMAN

NCBI Description

Gamma-aminobutyric acid (GABA) is a major inhibitory neurotransmitter. GABAergic neurotransmission is terminated by the uptake of GABA into the presynaptic terminal and the surrounding astroglial cells by sodium-dependent transporters, such as SLC6A11 (Borden et al., 1994 [PubMed 7874447]).[supplied by OMIM, Nov 2010]

Uniprot Description

Function: Terminates the action of GABA by its high affinity sodium-dependent reuptake into presynaptic terminals.

Subcellular location: Membrane; Multi-pass membrane protein.

Tissue specificity: Widespread distribution in the brain.

Sequence similarities: Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A11 subfamily. [View classification]

Research Articles on SLC6A11

Similar Products

Product Notes

The SLC6A11 slc6a11 (Catalog #AAA645839) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC6A11 (GABT3, GAT3, Sodium- and Chloride-dependent GABA Transporter 3, Solute Carrier Family 6 Member 11, GAT-3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC6A11 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the SLC6A11 slc6a11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TELPWATCGH EWNTENCVEF QKLNVSNYSH VSLQNATSPV MEFWEHRVLA ISDGIEHIGN LR*. It is sometimes possible for the material contained within the vial of "SLC6A11, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.