Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLC5A2 Monoclonal Antibody | anti-SLC5A2 antibody

SLC5A2 (SGLT2, Sodium/Glucose Cotransporter 2, Low Affinity Sodium-glucose Cotransporter, Solute Carrier Family 5 Member 2) (MaxLight 550)

Gene Names
SLC5A2; SGLT2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC5A2; Monoclonal Antibody; SLC5A2 (SGLT2; Sodium/Glucose Cotransporter 2; Low Affinity Sodium-glucose Cotransporter; Solute Carrier Family 5 Member 2) (MaxLight 550); anti-SLC5A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G8
Specificity
Recognizes human SLC5A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-SLC5A2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa228-278 from human SLC5A2 (NP_003032) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP*
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SLC5A2 antibody
This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria.
Product Categories/Family for anti-SLC5A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
72,897 Da
NCBI Official Full Name
sodium/glucose cotransporter 2
NCBI Official Synonym Full Names
solute carrier family 5 (sodium/glucose cotransporter), member 2
NCBI Official Symbol
SLC5A2
NCBI Official Synonym Symbols
SGLT2
NCBI Protein Information
sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; solute carrier family 5 member 2; low affinity sodium-glucose cotransporter; solute carrier family 5 (sodium/glucose transporter), member 2
UniProt Protein Name
Sodium/glucose cotransporter 2
UniProt Gene Name
SLC5A2
UniProt Synonym Gene Names
SGLT2; Na(+)/glucose cotransporter 2
UniProt Entry Name
SC5A2_HUMAN

NCBI Description

This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. [provided by RefSeq, Sep 2009]

Uniprot Description

SLC5A2: Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1. Defects in SLC5A2 are the cause of renal glucosuria (GLYS1). GLYS1 is an autosomal recessive disorder characterized by a normal fasting serum glucose concentration and persistent isolated glucosuria, with a normal glucose tolerance test. Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.

Protein type: Membrane protein, integral; Transporter, SLC family; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: plasma membrane; integral to membrane

Molecular Function: low-affinity glucose:sodium symporter activity

Biological Process: transport; sodium ion transport; carbohydrate metabolic process; glucose transport; transmembrane transport

Disease: Renal Glucosuria

Research Articles on SLC5A2

Similar Products

Product Notes

The SLC5A2 slc5a2 (Catalog #AAA6214049) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC5A2 (SGLT2, Sodium/Glucose Cotransporter 2, Low Affinity Sodium-glucose Cotransporter, Solute Carrier Family 5 Member 2) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC5A2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC5A2 slc5a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC5A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.