Mouse anti-Human SLC5A2 Monoclonal Antibody | anti-SLC5A2 antibody

SLC5A2 (SGLT2, Sodium/Glucose Cotransporter 2, Low Affinity Sodium-glucose Cotransporter, Solute Carrier Family 5 Member 2) (HRP)

Cat. Num. AAA6155047

• Gene Names: SLC5A2; SGLT2
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLC5A2; Monoclonal Antibody; SLC5A2 (SGLT2; Sodium/Glucose Cotransporter 2; Low Affinity Sodium-glucose Cotransporter; Solute Carrier Family 5 Member 2) (HRP); anti-SLC5A2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G8
• Specificity: Recognizes human SLC5A2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SLC5A2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa228-278 from human SLC5A2 (NP_003032) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GLFDKYLGAATSLTVSEDPAVGNISSFCYRPRPDSYHLLRHPVTGDLPWP*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.61kD).)

Western Blot (WB)

(Western Blot analysis of SLC5A2 expression in transfected 293T cell line by SLC5A2 monoclonal antibody. Lane 1: SLC5A2 transfected lysate (72.9kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SLC5A2 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-SLC5A2 antibody

This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria.

Product Categories/Family for anti-SLC5A2 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 4507033
• NCBI GeneID: 6524
• NCBI Accession #: NP_003032.1
• NCBI GenBank Nucleotide #: NM_003041
• UniProt Accession #: P31639
• Molecular Weight: 72,897 Da
• NCBI Official Full Name: sodium/glucose cotransporter 2
• NCBI Official Synonym Full Names: solute carrier family 5 (sodium/glucose cotransporter), member 2
• NCBI Official Symbol: SLC5A2
• NCBI Official Synonym Symbols: SGLT2
• NCBI Protein Information: sodium/glucose cotransporter 2; Na(+)/glucose cotransporter 2; solute carrier family 5 member 2; low affinity sodium-glucose cotransporter; solute carrier family 5 (sodium/glucose transporter), member 2
• UniProt Protein Name: Sodium/glucose cotransporter 2
• Protein Family: Sodium/glucose cotransporter
• UniProt Gene Name: SLC5A2
• UniProt Synonym Gene Names: SGLT2; Na(+)/glucose cotransporter 2
• UniProt Entry Name: SC5A2_HUMAN

NCBI Description

This gene encodes a member of the sodium glucose cotransporter family which are sodium-dependent glucose transport proteins. The encoded protein is the major cotransporter involved in glucose reabsorption in the kidney. Mutations in this gene are associated with renal glucosuria. [provided by RefSeq, Sep 2009]

Uniprot Description

SLC5A2: Sodium-dependent glucose transporter. Has a Na(+) to glucose coupling ratio of 1:1. Defects in SLC5A2 are the cause of renal glucosuria (GLYS1). GLYS1 is an autosomal recessive disorder characterized by a normal fasting serum glucose concentration and persistent isolated glucosuria, with a normal glucose tolerance test. Belongs to the sodium:solute symporter (SSF) (TC 2.A.21) family.

Protein type: Membrane protein, integral; Transporter, SLC family; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16p11.2

Cellular Component: plasma membrane; integral to membrane

Molecular Function: low-affinity glucose:sodium symporter activity

Biological Process: transport; sodium ion transport; carbohydrate metabolic process; glucose transport; transmembrane transport

Disease: Renal Glucosuria