Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SLC45A2 is approximately 0.03ng/ml as a capture antibody.)

Mouse SLC45A2 Monoclonal Antibody | anti-SLC45A2 antibody

SLC45A2 (Solute Carrier Family 45, Member 2, 1A1, AIM1, MATP, SHEP5) (PE)

Gene Names
SLC45A2; 1A1; AIM1; MATP; OCA4; SHEP5
Applications
Western Blot
Purity
Purified
Synonyms
SLC45A2; Monoclonal Antibody; SLC45A2 (Solute Carrier Family 45; Member 2; 1A1; AIM1; MATP; SHEP5) (PE); Solute Carrier Family 45; SHEP5; anti-SLC45A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1B2
Specificity
Recognizes SLC45A2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
243
Applicable Applications for anti-SLC45A2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SLC45A2 (AAH03597, 1aa-243aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MGSNSGQAGRHIYKSLADDGPFDSVEPPKRPTSRLIMHSMAMFGREFCYAVEAAYVTPVLLSVGLPSSLYSIVWFLSPILGFLLQPVVGSASDHCRSRWGRRRPYILTLGVMMLVGMALYLNGATVVAALIANPRRKLVWAISVTMIGVVLFDFAADFIDGPIKAYLFDVCSHQDKEKGLHYHALFTDSQGNDIKVTAESTGEHASSLPLPLHQPPHWMDGLPVQHAVLHRFHGPDCVPRGSL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC45A2 is approximately 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC45A2 is approximately 0.03ng/ml as a capture antibody.)
Related Product Information for anti-SLC45A2 antibody
This gene encodes a transporter protein that mediates melanin synthesis. The protein is expressed in a high percentage of melanoma cell lines. Mutations in this gene are a cause of oculocutaneous albinism type 4, and polymorphisms in this gene are associated with variations in skin and hair color. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Product Categories/Family for anti-SLC45A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
SLC45A2 protein
NCBI Official Synonym Full Names
solute carrier family 45 member 2
NCBI Official Symbol
SLC45A2
NCBI Official Synonym Symbols
1A1; AIM1; MATP; OCA4; SHEP5
NCBI Protein Information
membrane-associated transporter protein

NCBI Description

This gene encodes a transporter protein that mediates melanin synthesis. The protein is expressed in a high percentage of melanoma cell lines. Mutations in this gene are a cause of oculocutaneous albinism type 4, and polymorphisms in this gene are associated with variations in skin and hair color. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009]

Research Articles on SLC45A2

Similar Products

Product Notes

The SLC45A2 (Catalog #AAA6183950) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC45A2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC45A2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC45A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.