Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Mouse anti-Human SLC44A2 Monoclonal Antibody | anti-SLC44A2 antibody

SLC44A2 (CTL2, Solute Carrier Family 44, Member 2, CTL2, DKFZp666A071, FLJ44586, PP1292)

Gene Names
SLC44A2; CTL2; PP1292
Reactivity
Human
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC44A2; Monoclonal Antibody; SLC44A2 (CTL2; Solute Carrier Family 44; Member 2; CTL2; DKFZp666A071; FLJ44586; PP1292); Anti -SLC44A2 (CTL2; anti-SLC44A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3D11
Specificity
Recognizes human CTL2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
YLNARSSRDFEYYKQFCVPGFKNNKGVAEVLRDGDCPAVLIPSKPLARRCFPAIHAYKGVLMVGNETTYEDGHGSRKNITDLVEGAKKANGVLEARQLAMRIFEDYTV
Applicable Applications for anti-SLC44A2 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Western Blot and Immunohistochemistry.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa123-231 from human CTL2 (AAH40556) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.99kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.99kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SLC44A2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SLC44A2 on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SLC44A2 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC44A2 is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-SLC44A2 antibody
Isoform 1, but not isoform 3, exhibits some choline transporter activity.
Product Categories/Family for anti-SLC44A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
80,124 Da
NCBI Official Full Name
SLC44A2 protein, partial
NCBI Official Synonym Full Names
solute carrier family 44 (choline transporter), member 2
NCBI Official Symbol
SLC44A2
NCBI Official Synonym Symbols
CTL2; PP1292
NCBI Protein Information
choline transporter-like protein 2; solute carrier family 44, member 2
UniProt Protein Name
Choline transporter-like protein 2
UniProt Gene Name
SLC44A2
UniProt Synonym Gene Names
CTL2
UniProt Entry Name
CTL2_HUMAN

Uniprot Description

SLC44A2: Isoform 1, but not isoform 3, exhibits some choline transporter activity. Belongs to the CTL (choline transporter-like) family. 3 isoforms of the human protein are produced by alternative promoter.

Protein type: Transporter; Transporter, SLC family; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.1

Cellular Component: lysosomal membrane; plasma membrane; integral to membrane

Molecular Function: signal transducer activity; choline transmembrane transporter activity

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; phospholipid metabolic process; glycerophospholipid biosynthetic process; phosphatidylcholine biosynthetic process; signal transduction; choline transport; transmembrane transport

Research Articles on SLC44A2

Similar Products

Product Notes

The SLC44A2 slc44a2 (Catalog #AAA6005050) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC44A2 (CTL2, Solute Carrier Family 44, Member 2, CTL2, DKFZp666A071, FLJ44586, PP1292) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC44A2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Western Blot and Immunohistochemistry. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the SLC44A2 slc44a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YLNARSSRDF EYYKQFCVPG FKNNKGVAEV LRDGDCPAVL IPSKPLARRC FPAIHAYKGV LMVGNETTYE DGHGSRKNIT DLVEGAKKAN GVLEARQLAM RIFEDYTV. It is sometimes possible for the material contained within the vial of "SLC44A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.