Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.92kD).)

Mouse anti-Human SLC36A2 Monoclonal Antibody | anti-SLC36A2 antibody

SLC36A2 (Solute Carrier Family 36 Member 2, Proton-coupled Amino Acid Transporter 2, Proton/amino Acid Transporter 2, PAT2, Tramdorin-1, TRAMD1) (AP)

Gene Names
SLC36A2; PAT2; TRAMD1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC36A2; Monoclonal Antibody; SLC36A2 (Solute Carrier Family 36 Member 2; Proton-coupled Amino Acid Transporter 2; Proton/amino Acid Transporter 2; PAT2; Tramdorin-1; TRAMD1) (AP); anti-SLC36A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2H3
Specificity
Recognizes human SLC36A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SLC36A2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa1-72 from human SLC36A2 (NP_861441) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSVTKSTEGPQGAVAIKLDLMSPPESAKKLENKDSTFLDESPSESAGLKKTKGITVFQALIHLVKGNMGTG
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.92kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.92kD).)

Western Blot (WB)

(SLC36A2 monoclonal antibody. Western Blot analysis of SLC36A2 expression in A-431.)

Western Blot (WB) (SLC36A2 monoclonal antibody. Western Blot analysis of SLC36A2 expression in A-431.)
Product Categories/Family for anti-SLC36A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Predicted: 53 kDa
Observed: 52 kDa
NCBI Official Full Name
proton-coupled amino acid transporter 2
NCBI Official Synonym Full Names
solute carrier family 36 member 2
NCBI Official Symbol
SLC36A2
NCBI Official Synonym Symbols
PAT2; TRAMD1
NCBI Protein Information
proton-coupled amino acid transporter 2
UniProt Protein Name
Proton-coupled amino acid transporter 2
UniProt Gene Name
SLC36A2
UniProt Synonym Gene Names
PAT2; TRAMD1; Proton/amino acid transporter 2
UniProt Entry Name
S36A2_HUMAN

NCBI Description

This gene encodes a pH-dependent proton-coupled amino acid transporter that belongs to the amino acid auxin permease 1 protein family. The encoded protein primarily transports small amino acids such as glycine, alanine and proline. Mutations in this gene are associated with iminoglycinuria and hyperglycinuria. [provided by RefSeq, Sep 2010]

Uniprot Description

SLC36A2: Involved in a pH-dependent electrogenic neuronal transport and sequestration of small amino acids. Transports glycine and proline. Inhibited by sarcosine. Defects in SLC36A2 are a cause of hyperglycinuria (HG). It is a condition characterized by excess of glycine in the urine. In some cases it is associated with renal colic and renal oxalate stones. Defects in SLC36A2 are a cause of iminoglycinuria (IG). It is a disorder of renal tubular reabsorption of glycine and imino acids (proline and hydroxyproline), marked by excessive levels of all three substances in the urine. Mutations in SLC36A2 that retain residual transport activity result in the IG phenotype only when combined with haploinsufficiency of the imino acid transporter SLC6A20 or deficiency of the neutral amino acid transporter SLC6A19. Additional polymorphisms and mutations in SLC6A18 can contribute to iminoglycinuria in some families. Belongs to the amino acid/polyamine transporter 2 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 5q33.1

Cellular Component: cytoplasm; integral to membrane; plasma membrane

Molecular Function: amino acid transmembrane transporter activity; glycine transmembrane transporter activity; hydrogen ion transmembrane transporter activity; hydrogen:amino acid symporter activity; L-alanine transmembrane transporter activity; L-proline transmembrane transporter activity

Biological Process: amino acid transport; glycine transport; ion transport; L-alanine transport

Disease: Hyperglycinuria; Iminoglycinuria

Research Articles on SLC36A2

Similar Products

Product Notes

The SLC36A2 slc36a2 (Catalog #AAA6133826) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC36A2 (Solute Carrier Family 36 Member 2, Proton-coupled Amino Acid Transporter 2, Protomino Acid Transporter 2, PAT2, Tramdorin-1, TRAMD1) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC36A2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC36A2 slc36a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC36A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.