Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.49kD).)

Mouse anti-Human SLC35D2 Monoclonal Antibody | anti-SLC35D2 antibody

SLC35D2 (Solute Carrier Family 35 Member D2, Homolog of Fringe Connection Protein 1, HFRC1, HFRC, SQV7-like Protein, SQV7L, UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose Transporter, UDP-galactose Transporter-related Protein 8, UGTrel8) (FITC)

Gene Names
SLC35D2; hfrc; HFRC1; SQV7L; UGTrel8
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC35D2; Monoclonal Antibody; SLC35D2 (Solute Carrier Family 35 Member D2; Homolog of Fringe Connection Protein 1; HFRC1; HFRC; SQV7-like Protein; SQV7L; UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose Transporter; UDP-galactose Transporter-related Protein 8; UGTrel8) (FITC); anti-SLC35D2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a, lambda
Clone Number
1H5
Specificity
Recognizes human SLC35D2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-SLC35D2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa74-132 from human SLC35D2 (NP_008932) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VSKLNKIIHFPDFDKKIPVKLFPLPLLYVGNHISGLSSTSKLSLPMFTVLRKFTIPLT
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.49kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.49kD).)
Product Categories/Family for anti-SLC35D2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26,702 Da
NCBI Official Full Name
UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter isoform a
NCBI Official Synonym Full Names
solute carrier family 35 (UDP-GlcNAc/UDP-glucose transporter), member D2
NCBI Official Symbol
SLC35D2
NCBI Official Synonym Symbols
hfrc; HFRC1; SQV7L; UGTrel8
NCBI Protein Information
UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter; SQV7-like protein; fringe connection; UDP-N-acetylglucosamine transporter; solute carrier family 35, member D2; homolog of Fringe connection protein 1; UDP-galactose transporter-related protein
UniProt Protein Name
UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose transporter
UniProt Gene Name
SLC35D2
UniProt Synonym Gene Names
HFRC; UGTREL8; HFRC1; SQV7L; UGTrel8
UniProt Entry Name
S35D2_HUMAN

NCBI Description

Nucleotide sugars, which are synthesized in the cytosol or the nucleus, are high-energy donor substrates for glycosyltransferases located in the lumen of the endoplasmic reticulum and Golgi apparatus. Translocation of nucleotide sugars from the cytosol into the lumen compartment is mediated by specific nucleotide sugar transporters, such as SLC35D2 (Suda et al., 2004 [PubMed 15082721]).[supplied by OMIM, Mar 2008]

Uniprot Description

SLC35D2: Antiporter transporting nucleotide sugars such as UDP-N- acetylglucosamine (UDP-GlcNAc), UDP-glucose (UDP-Glc) and GDP- mannose (GDP-Man) pooled in the cytosol into the lumen of the Golgi in exchange for the corresponding nucleosides monophosphates (UMP for UDP-sugars and GMP for GDP-sugars). May take part in heparan sulfate synthesis by supplying UDP-Glc-NAc, the donor substrate, and thus be involved in growth factor signaling. Belongs to the TPT transporter family. SLC35D subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter, SLC family; Membrane protein, integral; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 9q22.32

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: nucleotide-sugar transmembrane transporter activity

Biological Process: keratan sulfate metabolic process; glycosaminoglycan biosynthetic process; glycosaminoglycan metabolic process; carbohydrate transport; carbohydrate metabolic process; keratan sulfate biosynthetic process; pathogenesis; transmembrane transport

Research Articles on SLC35D2

Similar Products

Product Notes

The SLC35D2 slc35d2 (Catalog #AAA6149734) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC35D2 (Solute Carrier Family 35 Member D2, Homolog of Fringe Connection Protein 1, HFRC1, HFRC, SQV7-like Protein, SQV7L, UDP-N-acetylglucosamine/UDP-glucose/GDP-mannose Transporter, UDP-galactose Transporter-related Protein 8, UGTrel8) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC35D2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC35D2 slc35d2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC35D2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.