Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SLC2A4 is 1 ng/ml as a capture antibody.)

Mouse SLC2A4 Monoclonal Antibody | anti-SLC2A4 antibody

SLC2A4 (Solute Carrier Family 2 (Facilitated Glucose Transporter), Member 4, GLUT4) (Biotin)

Gene Names
SLC2A4; GLUT4
Applications
Western Blot
Purity
Purified
Synonyms
SLC2A4; Monoclonal Antibody; SLC2A4 (Solute Carrier Family 2 (Facilitated Glucose Transporter); Member 4; GLUT4) (Biotin); Solute Carrier Family 2 (Facilitated Glucose Transporter); GLUT4; anti-SLC2A4 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4B4
Specificity
Recognizes SLC2A4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-SLC2A4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
SLC2A4 (NP_001033, 467aa-509aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SLC2A4 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC2A4 is 1 ng/ml as a capture antibody.)
Related Product Information for anti-SLC2A4 antibody
This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq]
Product Categories/Family for anti-SLC2A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55kDa
NCBI Official Full Name
solute carrier family 2, facilitated glucose transporter member 4
NCBI Official Synonym Full Names
solute carrier family 2 member 4
NCBI Official Symbol
SLC2A4
NCBI Official Synonym Symbols
GLUT4
NCBI Protein Information
solute carrier family 2, facilitated glucose transporter member 4
UniProt Protein Name
Solute carrier family 2, facilitated glucose transporter member 4
Protein Family
UniProt Gene Name
SLC2A4
UniProt Synonym Gene Names
GLUT4; GLUT-4
UniProt Entry Name
GTR4_HUMAN

NCBI Description

This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq, Jul 2008]

Uniprot Description

GLUT4: an integral membrane facilitative glucose transporter. One of 13 members of the human equilibrative glucose transport protein family. Its surface expression is regulated by insulin. Has two internalization sequences, a dileucine repeat present in the C-terminus and a FxxY motif in the amino-terminal end. Associates with an intracellular tubulo-vesicular compartment under low plasma conditions. The binding of insulin to the insulin receptor (a typosine kinase) leads to the rapid translocation of GLUT4 to the cell surface, increasing cellular glucose transport activity. Its translocation to the plasma membrane is also stimulated by exercise, but independent from insulin signaling. This insulin-independent pathway may be regulated by AMPK.

Protein type: Transporter, SLC family; Transporter; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: multivesicular body; trans-Golgi network transport vesicle; membrane; clathrin-coated vesicle; integral to plasma membrane; perinuclear region of cytoplasm; T-tubule; plasma membrane; endomembrane system; coated pit; vesicle membrane; cytosol; lipid raft; external side of plasma membrane

Molecular Function: D-glucose transmembrane transporter activity; protein binding; glucose transmembrane transporter activity

Biological Process: amylopectin biosynthetic process; response to ethanol; cellular response to insulin stimulus; glucose import; hexose transport; carbohydrate metabolic process; brown fat cell differentiation; pathogenesis; glucose transport; glucose homeostasis; transmembrane transport

Disease: Diabetes Mellitus, Noninsulin-dependent

Research Articles on SLC2A4

Similar Products

Product Notes

The SLC2A4 slc2a4 (Catalog #AAA6173590) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's SLC2A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC2A4 slc2a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC2A4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.