Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.14kD).)

Mouse anti-Human SLC25A23 Monoclonal Antibody | anti-SLC25A23 antibody

SLC25A23 (Calcium-binding Mitochondrial Carrier Protein SCaMC-3, Mitochondrial ATP-Mg/Pi Carrier Protein 2, Mitochondrial Ca(2+)-dependent Solute Carrier Protein 2, Small Calcium-binding Mitochondrial Carrier Protein 3, Solute Carrier Family 25 Member 23,

Gene Names
SLC25A23; APC2; MCSC2; SCaMC-3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC25A23; Monoclonal Antibody; SLC25A23 (Calcium-binding Mitochondrial Carrier Protein SCaMC-3; Mitochondrial ATP-Mg/Pi Carrier Protein 2; Mitochondrial Ca(2+)-dependent Solute Carrier Protein 2; Small Calcium-binding Mitochondrial Carrier Protein 3; Solute Carrier Family 25 Member 23; ; anti-SLC25A23 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E1
Specificity
Recognizes human SLC25A23.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-SLC25A23 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa2-75 from human SLC25A23 (NP_077008) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RGSPGDAERRQRWGRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRY
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.14kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.14kD).)

Testing Data

(Detection limit for recombinant GST tagged SLC25A23 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC25A23 is 1ng/ml as a capture antibody.)
Related Product Information for anti-SLC25A23 antibody
SLC25A23 is a calcium dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.
Product Categories/Family for anti-SLC25A23 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
48,786 Da
NCBI Official Full Name
calcium-binding mitochondrial carrier protein SCaMC-3
NCBI Official Synonym Full Names
solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23
NCBI Official Symbol
SLC25A23
NCBI Official Synonym Symbols
APC2; MCSC2; SCaMC-3
NCBI Protein Information
calcium-binding mitochondrial carrier protein SCaMC-3; mitochondrial ATP-Mg/Pi carrier protein 2; mitochondrial Ca(2+)-dependent solute carrier protein 2; mitochondrial Ca2+-dependent solute carrier protein 2; short calcium-binding mitochondrial carrier 3
UniProt Protein Name
Calcium-binding mitochondrial carrier protein SCaMC-3
UniProt Gene Name
SLC25A23
UniProt Synonym Gene Names
APC2; MCSC2; SCAMC3
UniProt Entry Name
SCMC3_HUMAN

Similar Products

Product Notes

The SLC25A23 slc25a23 (Catalog #AAA6133803) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC25A23 (Calcium-binding Mitochondrial Carrier Protein SCaMC-3, Mitochondrial ATP-Mg/Pi Carrier Protein 2, Mitochondrial Ca(2+)-dependent Solute Carrier Protein 2, Small Calcium-binding Mitochondrial Carrier Protein 3, Solute Carrier Family 25 Member 23, reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A23 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC25A23 slc25a23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC25A23, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.