Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLC25A20 Monoclonal Antibody | anti-SLC25A20 antibody

SLC25A20 (Mitochondrial Carnitine/Acylcarnitine Carrier Protein, Carnitine/Acylcarnitine Translocase, CAC, Solute Carrier Family 25 Member 20, CAC, CACT) (MaxLight 490)

Gene Names
SLC25A20; CAC; CACT
Reactivity
Human
Applications
Immunofluorescence
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC25A20; Monoclonal Antibody; SLC25A20 (Mitochondrial Carnitine/Acylcarnitine Carrier Protein; Carnitine/Acylcarnitine Translocase; CAC; Solute Carrier Family 25 Member 20; CACT) (MaxLight 490); anti-SLC25A20 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
M2
Specificity
Recognizes human SLC25A20.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight490.
Applicable Applications for anti-SLC25A20 antibody
FLISA, Immunofluorescence (IF)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-301 from human SLC25A20 (AAH01689) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MADQPKPISPLKNLLAGGFGGVCLVFAGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL
Conjugate
MaxLight490
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight490 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-SLC25A20 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
788
Molecular Weight
32,944 Da
NCBI Official Full Name
Homo sapiens solute carrier family 25 (carnitine/acylcarnitine translocase), member 20, mRNA
NCBI Official Synonym Full Names
solute carrier family 25 member 20
NCBI Official Symbol
SLC25A20
NCBI Official Synonym Symbols
CAC; CACT
NCBI Protein Information
mitochondrial carnitine/acylcarnitine carrier protein

NCBI Description

This gene product is one of several closely related mitochondrial-membrane carrier proteins that shuttle substrates between cytosol and the intramitochondrial matrix space. This protein mediates the transport of acylcarnitines into mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway. Mutations in this gene are associated with carnitine-acylcarnitine translocase deficiency, which can cause a variety of pathological conditions such as hypoglycemia, cardiac arrest, hepatomegaly, hepatic dysfunction and muscle weakness, and is usually lethal in new born and infants. [provided by RefSeq, Jul 2008]

Research Articles on SLC25A20

Similar Products

Product Notes

The SLC25A20 (Catalog #AAA6203340) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC25A20 (Mitochondrial Carnitine/Acylcarnitine Carrier Protein, Carnitine/Acylcarnitine Translocase, CAC, Solute Carrier Family 25 Member 20, CAC, CACT) (MaxLight 490) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC25A20 can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC25A20 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC25A20, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.