Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Mouse anti-Human, Mouse SLC22A6 Monoclonal Antibody | anti-SLC22A6 antibody

SLC22A6 (Solute Carrier Family 22 Member 6, Organic Anion Transporter 1, OAT1, hOAT1, PAH Transporter, PAHT, hPAHT, Renal Organic Anion Transporter 1, ROAT1, hROAT1)

Gene Names
SLC22A6; OAT1; PAHT; HOAT1; ROAT1
Reactivity
Human, Mouse
Applications
ELISA, Western Blot, Immunohistochemistry
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SLC22A6; Monoclonal Antibody; SLC22A6 (Solute Carrier Family 22 Member 6; Organic Anion Transporter 1; OAT1; hOAT1; PAH Transporter; PAHT; hPAHT; Renal Organic Anion Transporter 1; ROAT1; hROAT1); Anti -SLC22A6 (Solute Carrier Family 22 Member 6; anti-SLC22A6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG1, kappa
Clone Number
1F2
Specificity
Recognizes human SLC22A6.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
TMIRQTGMGMGSTMARVGSIVSPLVSMTAELYPSMPLFIYGAVPVAASAVTVLLPETLGQPLPDTVQDLESRKGKQTRQQQEHQKYMVPLQASAQEKNGL
Applicable Applications for anti-SLC22A6 antibody
ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC)
Application Notes
Suitable for use in ELISA, Immunohistochemistry and Western Blot.
Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
Immunogen
Partial recombinant corresponding to aa451-550 from SLC22A6 (AAH33682) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.63kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.63kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SLC22A6 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SLC22A6 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SLC22A6 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC22A6 is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-SLC22A6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
61,816 Da
NCBI Official Full Name
solute carrier family 22 member 6 isoform d
NCBI Official Synonym Full Names
solute carrier family 22 (organic anion transporter), member 6
NCBI Official Symbol
SLC22A6
NCBI Official Synonym Symbols
OAT1; PAHT; HOAT1; ROAT1
NCBI Protein Information
solute carrier family 22 member 6; hPAHT; hROAT1; PAH transporter; organic anion transporter 1; para-aminohippurate transporter; renal organic anion transporter 1
UniProt Protein Name
Solute carrier family 22 member 6
Protein Family
UniProt Gene Name
SLC22A6
UniProt Synonym Gene Names
OAT1; PAHT; hOAT1; hPAHT; hROAT1
UniProt Entry Name
S22A6_HUMAN

NCBI Description

The protein encoded by this gene is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC22A6: Involved in the renal elimination of endogenous and exogenous organic anions. Functions as organic anion exchanger when the uptake of one molecule of organic anion is coupled with an efflux of one molecule of endogenous dicarboxylic acid (glutarate, ketoglutarate, etc). Mediates the sodium-independent uptake of 2,3-dimercapto-1-propanesulfonic acid (DMPS). Mediates the sodium-independent uptake of p- aminohippurate (PAH), ochratoxin (OTA), acyclovir (ACV), 3'-azido- 3-'deoxythymidine (AZT), cimetidine (CMD), 2,4-dichloro- phenoxyacetate (2,4-D), hippurate (HA), indoleacetate (IA), indoxyl sulfate (IS) and 3-carboxy-4-methyl-5-propyl-2- furanpropionate (CMPF), cidofovir, adefovir, 9-(2- phosphonylmethoxyethyl) guanine (PMEG), 9-(2- phosphonylmethoxyethyl) diaminopurine (PMEDAP) and edaravone sulfate. PAH uptake is inhibited by p- chloromercuribenzenesulphonate (PCMBS), diethyl pyrocarbonate (DEPC), sulindac, diclofenac, carprofen, glutarate and okadaic acid. PAH uptake is inhibited by benzothiazolylcysteine (BTC), S-chlorotrifluoroethylcysteine (CTFC), cysteine S-conjugates S-dichlorovinylcysteine (DCVC), furosemide, steviol, phorbol 12-myristate 13-acetate (PMA), calcium ionophore A23187, benzylpenicillin, furosemide, indomethacin, bumetamide, losartan, probenecid, phenol red, urate, and alpha-ketoglutarate. Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Transporter; Transporter, SLC family

Chromosomal Location of Human Ortholog: 11q12.3

Cellular Component: protein complex; integral to plasma membrane; basolateral plasma membrane; plasma membrane; caveola

Molecular Function: protein binding; protein homodimerization activity; inorganic anion exchanger activity; organic anion transmembrane transporter activity; sodium-independent organic anion transmembrane transporter activity; chloride ion binding

Biological Process: sodium-independent organic anion transport; alpha-ketoglutarate transport; response to methotrexate; transmembrane transport; protein homooligomerization; organic anion transport

Research Articles on SLC22A6

Similar Products

Product Notes

The SLC22A6 slc22a6 (Catalog #AAA641902) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC22A6 (Solute Carrier Family 22 Member 6, Organic Anion Transporter 1, OAT1, hOAT1, PAH Transporter, PAHT, hPAHT, Renal Organic Anion Transporter 1, ROAT1, hROAT1) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC). Suitable for use in ELISA, Immunohistochemistry and Western Blot. Dilution: Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml. Researchers should empirically determine the suitability of the SLC22A6 slc22a6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TMIRQTGMGM GSTMARVGSI VSPLVSMTAE LYPSMPLFIY GAVPVAASAV TVLLPETLGQ PLPDTVQDLE SRKGKQTRQQ QEHQKYMVPL QASAQEKNGL. It is sometimes possible for the material contained within the vial of "SLC22A6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.