Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLC22A4 Monoclonal Antibody | anti-SLC22A4 antibody

SLC22A4 (ETT, OCTN1, UT2H, Solute Carrier Family 22 Member 4, Ergothioneine Transporter, ET transporter, Organic Cation/Carnitine Transporter 1, MGC34546, MGC40524) (AP)

Gene Names
SLC22A4; OCTN1; DFNB60
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC22A4; Monoclonal Antibody; SLC22A4 (ETT; OCTN1; UT2H; Solute Carrier Family 22 Member 4; Ergothioneine Transporter; ET transporter; Organic Cation/Carnitine Transporter 1; MGC34546; MGC40524) (AP); anti-SLC22A4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D3
Specificity
Recognizes human SLC22A4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
551
Applicable Applications for anti-SLC22A4 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa43-142 from human SLC22A4 (NP_003050) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AGTPEHRCRVPDAANLSSAWRNNSVPLRLRDGREVPHSCSRYRLATIANFSALGLEPGRDVDLGQLEQESCLDGWEFSQDVYLSTVVTEWNLVCEDNWK*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SLC22A4 antibody
Sodium-ion dependent, low affinity carnitine transporter. Probably transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Relative uptake activity ratio of carnitine to TEA is 1.78. A key substrate of this transporter seems to be ergothioneine (ET).
Product Categories/Family for anti-SLC22A4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
solute carrier family 22 member 4
NCBI Official Synonym Full Names
solute carrier family 22 member 4
NCBI Official Symbol
SLC22A4
NCBI Official Synonym Symbols
OCTN1; DFNB60
NCBI Protein Information
solute carrier family 22 member 4
UniProt Protein Name
Solute carrier family 22 member 4
Protein Family
UniProt Gene Name
SLC22A4
UniProt Synonym Gene Names
ETT; OCTN1; UT2H; ET transporter
UniProt Entry Name
S22A4_HUMAN

NCBI Description

Polyspecific organic cation transporters in the liver, kidney, intestine, and other organs are critical for elimination of many endogenous small organic cations as well as a wide array of drugs and environmental toxins. The encoded protein is an organic cation transporter and plasma integral membrane protein containing eleven putative transmembrane domains as well as a nucleotide-binding site motif. Transport by this protein is at least partially ATP-dependent. [provided by RefSeq, Jul 2008]

Uniprot Description

SLC22A4: Sodium-ion dependent, low affinity carnitine transporter. Probably transports one sodium ion with one molecule of carnitine. Also transports organic cations such as tetraethylammonium (TEA) without the involvement of sodium. Relative uptake activity ratio of carnitine to TEA is 1.78. A key substrate of this transporter seems to be ergothioneine (ET). Genetic variations in SLC22A4 are a cause of susceptibility to rheumatoid arthritis (RA). It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures. Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family.

Protein type: Mitochondrial; Transporter; Transporter, SLC family; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5q31.1

Cellular Component: mitochondrion; integral to plasma membrane; apical plasma membrane; plasma membrane

Molecular Function: protein binding; cation:cation antiporter activity; symporter activity; nucleotide binding; carnitine transporter activity; secondary active organic cation transmembrane transporter activity; quaternary ammonium group transmembrane transporter activity; ATP binding; PDZ domain binding

Biological Process: organic cation transport; triacylglycerol metabolic process; quaternary ammonium group transport; sodium ion transport; carnitine metabolic process; body fluid secretion; transmembrane transport; carnitine transport

Disease: Rheumatoid Arthritis

Research Articles on SLC22A4

Similar Products

Product Notes

The SLC22A4 slc22a4 (Catalog #AAA6133794) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC22A4 (ETT, OCTN1, UT2H, Solute Carrier Family 22 Member 4, Ergothioneine Transporter, ET transporter, Organic Cation/Carnitine Transporter 1, MGC34546, MGC40524) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC22A4 slc22a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC22A4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.