Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLC22A12 Monoclonal Antibody | anti-SLC22A12 antibody

SLC22A12 (Solute Carrier Family 22 Member 12, Organic Anion Transporter 4-like Protein, Renal-specific Transporter, RST, Urate Anion Exchanger 1, OATL4, URAT1, UNQ6453/PRO34004) (MaxLight 650)

Gene Names
SLC22A12; RST; OAT4L; URAT1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC22A12; Monoclonal Antibody; SLC22A12 (Solute Carrier Family 22 Member 12; Organic Anion Transporter 4-like Protein; Renal-specific Transporter; RST; Urate Anion Exchanger 1; OATL4; URAT1; UNQ6453/PRO34004) (MaxLight 650); anti-SLC22A12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B5
Specificity
Recognizes human SLC22A12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Sequence Length
553
Applicable Applications for anti-SLC22A12 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa281-350 from human SLC22A12 (NP_653186) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFR
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SLC22A12 antibody
Required for efficient urate re-absorption in the kidney. Regulates blood urate levels. Mediates saturable urate uptake by facilitating the exchange of urate against organic anions.
Product Categories/Family for anti-SLC22A12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
solute carrier family 22 member 12 isoform a
NCBI Official Synonym Full Names
solute carrier family 22 member 12
NCBI Official Symbol
SLC22A12
NCBI Official Synonym Symbols
RST; OAT4L; URAT1
NCBI Protein Information
solute carrier family 22 member 12
UniProt Protein Name
Solute carrier family 22 member 12
Protein Family
UniProt Gene Name
SLC22A12
UniProt Synonym Gene Names
OATL4; URAT1; RST
UniProt Entry Name
S22AC_HUMAN

NCBI Description

The protein encoded by this gene is a member of the organic anion transporter (OAT) family, and it acts as a urate transporter to regulate urate levels in blood. This protein is an integral membrane protein primarily found in epithelial cells of the proximal tubule of the kidney. An elevated level of serum urate, hyperuricemia, is associated with increased incidences of gout, and mutations in this gene cause renal hypouricemia type 1. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]

Uniprot Description

SLC22A12: Required for efficient urate re-absorption in the kidney. Regulates blood urate levels. Mediates saturable urate uptake by facilitating the exchange of urate against organic anions. Defects in SLC22A12 are the cause of hypouricemia renal type 1 (RHUC1). A disorder characterized by impaired uric acid reabsorption at the apical membrane of proximal renal tubule cells, and high urinary urate excretion. Patients often appear asymptomatic, but may be subject to exercise-induced acute renal failure, chronic renal dysfunction and nephrolithiasis. Belongs to the major facilitator (TC 2.A.1) superfamily. Organic cation transporter (TC 2.A.1.19) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Transporter, SLC family; Membrane protein, integral; Transporter

Chromosomal Location of Human Ortholog: 11q13.1

Cellular Component: brush border membrane; apical plasma membrane; integral to membrane; plasma membrane

Molecular Function: urate transmembrane transporter activity; PDZ domain binding

Biological Process: response to drug; urate transport; urate metabolic process; cellular homeostasis; organic acid transport; transmembrane transport

Disease: Hypouricemia, Renal, 1

Research Articles on SLC22A12

Similar Products

Product Notes

The SLC22A12 slc22a12 (Catalog #AAA6224681) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC22A12 (Solute Carrier Family 22 Member 12, Organic Anion Transporter 4-like Protein, Renal-specific Transporter, RST, Urate Anion Exchanger 1, OATL4, URAT1, UNQ6453/PRO34004) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC22A12 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC22A12 slc22a12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC22A12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.