Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SLC1A2 Monoclonal Antibody | anti-SLC1A2 antibody

SLC1A2 (Excitatory Amino Acid Transporter 2, Sodium-dependent Glutamate/Aspartate Transporter 2, Glutamate/Aspartate Transporter II, Solute Carrier Family 1 Member 2, EAAT2, GLT1) (MaxLight 405)

Gene Names
SLC1A2; HBGT; EAAT2; GLT-1; EIEE41
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC1A2; Monoclonal Antibody; SLC1A2 (Excitatory Amino Acid Transporter 2; Sodium-dependent Glutamate/Aspartate Transporter 2; Glutamate/Aspartate Transporter II; Solute Carrier Family 1 Member 2; EAAT2; GLT1) (MaxLight 405); anti-SLC1A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D8
Specificity
Recognizes human SLC1A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-SLC1A2 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa160-240 from human SLC1A2 (NP_004162) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG*
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SLC1A2 antibody
This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq]
Product Categories/Family for anti-SLC1A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
excitatory amino acid transporter 2 isoform 1
NCBI Official Synonym Full Names
solute carrier family 1 member 2
NCBI Official Symbol
SLC1A2
NCBI Official Synonym Symbols
HBGT; EAAT2; GLT-1; EIEE41
NCBI Protein Information
excitatory amino acid transporter 2
UniProt Protein Name
Excitatory amino acid transporter 2
UniProt Gene Name
SLC1A2
UniProt Synonym Gene Names
EAAT2; GLT1
UniProt Entry Name
EAA2_HUMAN

NCBI Description

This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Improper regulation of this gene is thought to be associated with several neurological disorders. Alternatively spliced transcript variants of this gene have been identified. [provided by RefSeq, Jun 2017]

Research Articles on SLC1A2

Similar Products

Product Notes

The SLC1A2 slc1a2 (Catalog #AAA6192652) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC1A2 (Excitatory Amino Acid Transporter 2, Sodium-dependent Glutamate/Aspartate Transporter 2, Glutamate/Aspartate Transporter II, Solute Carrier Family 1 Member 2, EAAT2, GLT1) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC1A2 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC1A2 slc1a2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC1A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.