Mouse anti-Human SLC1A2 Monoclonal Antibody | anti-SLC1A2 antibody

SLC1A2 (Excitatory Amino Acid Transporter 2, Sodium-dependent Glutamate/Aspartate Transporter 2, Glutamate/Aspartate Transporter II, Solute Carrier Family 1 Member 2, EAAT2, GLT1) (HRP)

Cat. Num. AAA6155000

• Gene Names: SLC1A2; HBGT; EAAT2; GLT-1; EIEE41
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SLC1A2; Monoclonal Antibody; SLC1A2 (Excitatory Amino Acid Transporter 2; Sodium-dependent Glutamate/Aspartate Transporter 2; Glutamate/Aspartate Transporter II; Solute Carrier Family 1 Member 2; EAAT2; GLT1) (HRP); anti-SLC1A2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 1D8
• Specificity: Recognizes human SLC1A2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SLC1A2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa160-240 from human SLC1A2 (NP_004162) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSAVVSLLNETVTEVPEETKMVIKKGLEFKDG*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.91kD).)

Western Blot (WB)

(SLC1A2 monoclonal antibody. Western Blot analysis of SLC1A2 expression in HeLa.)

Testing Data

(Detection limit for recombinant GST tagged SLC1A2 is ~0.03ng/ml as a capture antibody.)

Related Product Information for anti-SLC1A2 antibody

This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Mutations in and decreased expression of this protein are associated with amyotrophic lateral sclerosis. Alternatively spliced transcript variants of this gene have been described, but their full-length nature is not known. [provided by RefSeq]

Product Categories/Family for anti-SLC1A2 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 40254478
• NCBI GeneID: 6506
• NCBI Accession #: NP_004162
• NCBI GenBank Nucleotide #: NM_004171
• UniProt Accession #: P43004
• Molecular Weight: 62kDa
• NCBI Official Full Name: excitatory amino acid transporter 2 isoform 1
• NCBI Official Synonym Full Names: solute carrier family 1 member 2
• NCBI Official Symbol: SLC1A2
• NCBI Official Synonym Symbols: HBGT; EAAT2; GLT-1; EIEE41
• NCBI Protein Information: excitatory amino acid transporter 2
• UniProt Protein Name: Excitatory amino acid transporter 2
• Protein Family: Excitatory amino acid transporter
• UniProt Gene Name: SLC1A2
• UniProt Synonym Gene Names: EAAT2; GLT1
• UniProt Entry Name: EAA2_HUMAN

NCBI Description

This gene encodes a member of a family of solute transporter proteins. The membrane-bound protein is the principal transporter that clears the excitatory neurotransmitter glutamate from the extracellular space at synapses in the central nervous system. Glutamate clearance is necessary for proper synaptic activation and to prevent neuronal damage from excessive activation of glutamate receptors. Improper regulation of this gene is thought to be associated with several neurological disorders. Alternatively spliced transcript variants of this gene have been identified. [provided by RefSeq, Jun 2017]