Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.58kD).)

Mouse anti-Human SLC19A2 Monoclonal Antibody | anti-SLC19A2 antibody

SLC19A2 (Solute Carrier Family 19 Member 2, Thiamine Transporter 1, THT1, ThTr1, ThTr-1, Thiamine Carrier 1, TC1, THMD1, TRMA) (PE)

Gene Names
SLC19A2; TC1; THT1; TRMA; THMD1; THTR1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SLC19A2; Monoclonal Antibody; SLC19A2 (Solute Carrier Family 19 Member 2; Thiamine Transporter 1; THT1; ThTr1; ThTr-1; Thiamine Carrier 1; TC1; THMD1; TRMA) (PE); anti-SLC19A2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5B10
Specificity
Recognizes human SLC19A2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
3668
Applicable Applications for anti-SLC19A2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa209-285 from SLC19A2 (NP_008927.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PMPQKSLFFHHIPSTCQRVNGIKVQNGGIVTDTPASNHLPGWEDIESKIPLNMEEPPVEEPEPKPDRLLVLKVLWND
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.58kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.58kD).)

Western Blot (WB)

(SLC19A2 monoclonal antibody Western Blot analysis of SLC19A2 expression in A-431)

Western Blot (WB) (SLC19A2 monoclonal antibody Western Blot analysis of SLC19A2 expression in A-431)

Testing Data

(Detection limit for recombinant GST tagged SLC19A2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SLC19A2 is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-SLC19A2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens solute carrier family 19 (thiamine transporter), member 2 (SLC19A2), mRNA
NCBI Official Synonym Full Names
solute carrier family 19 member 2
NCBI Official Symbol
SLC19A2
NCBI Official Synonym Symbols
TC1; THT1; TRMA; THMD1; THTR1
NCBI Protein Information
thiamine transporter 1
Protein Family

NCBI Description

This gene encodes the thiamin transporter protein. Mutations in this gene cause thiamin-responsive megaloblastic anemia syndrome (TRMA), which is an autosomal recessive disorder characterized by diabetes mellitus, megaloblastic anemia and sensorineural deafness. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2016]

Research Articles on SLC19A2

Similar Products

Product Notes

The SLC19A2 (Catalog #AAA6160301) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SLC19A2 (Solute Carrier Family 19 Member 2, Thiamine Transporter 1, THT1, ThTr1, ThTr-1, Thiamine Carrier 1, TC1, THMD1, TRMA) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC19A2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SLC19A2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SLC19A2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.