Mouse anti-Human SIX4 Monoclonal Antibody | anti-SIX4 antibody

SIX4 (Sine Oculis Homeobox Homolog 4, Homeobox Protein SIX4, AREC3) (HRP)

Cat. Num. AAA6154979

• Gene Names: SIX4; AREC3
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SIX4; Monoclonal Antibody; SIX4 (Sine Oculis Homeobox Homolog 4; Homeobox Protein SIX4; AREC3) (HRP); anti-SIX4 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B8
• Specificity: Recognizes human SIX4.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-SIX4 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 1.7ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa672-781 from human SIX4 (NP_059116) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: GQDLLSVPMTQAALGEIVPTAEDQVGHPSPAVHQDFVQEHRLVLQSVANMKENFLSNSESKATSSLMMLDSKSKYVLDGMVDTVCEDLETDKKELAKLQTVQLDEDMQD
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.1kD).)

Western Blot (WB)

(SIX4 monoclonal antibody, Western Blot analysis of SIX4 expression in Hela NE)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SIX4 on formalin-fixed paraffin-embedded human endometrium. [antibody concentration 1.7ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged SIX4 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SIX4 antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 142976638
• NCBI GeneID: 51804
• NCBI Accession #: NP_059116
• NCBI GenBank Nucleotide #: NM_017420
• UniProt Accession #: Q9UIU6
• Molecular Weight: 83kDa
• NCBI Official Full Name: homeobox protein SIX4
• NCBI Official Synonym Full Names: SIX homeobox 4
• NCBI Official Symbol: SIX4
• NCBI Official Synonym Symbols: AREC3
• NCBI Protein Information: homeobox protein SIX4
• UniProt Protein Name: Homeobox protein SIX4
• Protein Family: Homeobox protein
• UniProt Gene Name: SIX4
• UniProt Entry Name: SIX4_HUMAN

NCBI Description

This gene encodes a member of the homeobox family, subfamily SIX. The drosophila homolog is a nuclear homeoprotein required for eye development. Studies in mouse show that this gene product functions as a transcription factor, and may have a role in the differentiation or maturation of neuronal cells. [provided by RefSeq, May 2010]

Uniprot Description

SIX4: a member of the homeobox family, subfamily SIX. The drosophila homolog is a nuclear homeoprotein required for eye development. Studies in mouse show that this gene product functions as a transcription factor, and may have a role in the differentiation or maturation of neuronal cells. [provided by RefSeq, May 2010]

Protein type: Cell development/differentiation; Transcription factor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 14q23

Cellular Component: cytoplasm; nucleus

Molecular Function: sequence-specific DNA binding; transcription factor activity

Biological Process: tongue development; anatomical structure morphogenesis; skeletal muscle development; inner ear morphogenesis; pharyngeal system development; transcription, DNA-dependent; thymus development; positive regulation of transcription, DNA-dependent; male gonad development; embryonic cranial skeleton morphogenesis; sarcomere organization; olfactory placode formation; regulation of epithelial cell proliferation; male sex differentiation; regulation of protein localization; generation of neurons; male sex determination; myoblast migration; regulation of synaptic growth at neuromuscular junction; positive regulation of transcription from RNA polymerase II promoter; negative regulation of neuron apoptosis; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis