Mouse anti-Human Sirtuin 3 Monoclonal Antibody | anti-SIRT3 antibody

Sirtuin 3 (SIRT3, hSIRT3, NAD-dependent Protein Deacetylase Sirtuin-3, Mitochondrial, Regulatory Protein SIR2 Homolog 3, SIR2-like Protein 3, SIR2L3) (HRP)

Cat. Num. AAA6154972

• Gene Names: SIRT3; SIR2L3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Sirtuin 3; Monoclonal Antibody; Sirtuin 3 (SIRT3; hSIRT3; NAD-dependent Protein Deacetylase Sirtuin-3; Mitochondrial; Regulatory Protein SIR2 Homolog 3; SIR2-like Protein 3; SIR2L3) (HRP); EC=3.5.1.-; anti-SIRT3 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 1A4
• Specificity: Recognizes human SIRT3.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 2882

• Applicable Applications for anti-SIRT3 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa297-400 from SIRT3 (NP_036371) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(estern Blot detection against Immunogen (37.44kD).)

Western Blot (WB)

(Western Blot analysis of SIRT3 expression in transfected 293T cell line by SIRT3 monoclonal antibody. Lane 1: SIRT3 transfected lysate (Predicted MW: 28.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SIRT3 is 3ng/ml as a capture antibody.)

Product Categories/Family for anti-SIRT3 antibody

Antibodies; Sirtuins

NCBI and Uniprot Product Information

• NCBI GI #: 1519244535
• NCBI GeneID: 23410
• NCBI Accession #: NM_012239.6
• NCBI GenBank Nucleotide #: NM_012239
• UniProt Accession #: Q9NTG7
• NCBI Official Full Name: Homo sapiens sirtuin 3 (SIRT3), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: sirtuin 3
• NCBI Official Symbol: SIRT3
• NCBI Official Synonym Symbols: SIR2L3
• NCBI Protein Information: NAD-dependent protein deacetylase sirtuin-3, mitochondrial
• UniProt Protein Name: NAD-dependent protein deacetylase sirtuin-3, mitochondrial
• Protein Family: NAD-dependent protein deacetylase sirtuin
• UniProt Gene Name: SIRT3
• UniProt Synonym Gene Names: SIR2L3; hSIRT3
• UniProt Entry Name: SIR3_HUMAN

NCBI Description

SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent the formation of cancer cells. SIRT3 has far-reaching effects on nuclear gene expression, cancer, cardiovascular disease, neuroprotection, aging, and metabolic control. [provided by RefSeq, May 2019]

Uniprot Description

SIRT3: a soluble mitochondrial NAD-dependent protein deacetylase. Can deacetylate and thereby activate a central metabolic regulator in the mitochondrial matrix, glutamate dehydrogenase. Mitochondrial proteins are hyperacetylated in SIRT3-deficient mice, but not in SIRT4 or SIRT5 deficient mice. SIRT3-deficient mice have no obvious metabolic phenotype, and the process of adaptive thermogenesis is normal. Can deacetylate and activate isocitrate dehydrogenase 2, an enzyme that participates in regulation of the citric acid cycle and the regeneration of antioxidants. Inhibited by nicotinamide, but not by trichostatin A. Its unprocessed form is enzymatically inactive. It is processed by mitochondrial processing peptidase (MPP) in the mitochondrial matrix to give an enzymatically active 28 kDa product.

Protein type: Deacetylase; EC 3.5.1.-; Mitochondrial

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: mitochondrion; membrane; mitochondrial matrix

Molecular Function: protein binding; enzyme binding; zinc ion binding; NAD-dependent histone deacetylase activity (H3-K14 specific); NAD+ ADP-ribosyltransferase activity

Biological Process: mitochondrion organization and biogenesis; protein amino acid ADP-ribosylation; protein amino acid deacetylation; organelle organization and biogenesis; aerobic respiration; aging