Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (estern Blot detection against Immunogen (37.44kD).)

Mouse anti-Human Sirtuin 3 Monoclonal Antibody | anti-SIRT3 antibody

Sirtuin 3 (SIRT3, hSIRT3, NAD-dependent Protein Deacetylase Sirtuin-3, Mitochondrial, Regulatory Protein SIR2 Homolog 3, SIR2-like Protein 3, SIR2L3) (HRP)

Gene Names
SIRT3; SIR2L3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Sirtuin 3; Monoclonal Antibody; Sirtuin 3 (SIRT3; hSIRT3; NAD-dependent Protein Deacetylase Sirtuin-3; Mitochondrial; Regulatory Protein SIR2 Homolog 3; SIR2-like Protein 3; SIR2L3) (HRP); EC=3.5.1.-; anti-SIRT3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1A4
Specificity
Recognizes human SIRT3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
2882
Applicable Applications for anti-SIRT3 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa297-400 from SIRT3 (NP_036371) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(estern Blot detection against Immunogen (37.44kD).)

Western Blot (WB) (estern Blot detection against Immunogen (37.44kD).)

Western Blot (WB)

(Western Blot analysis of SIRT3 expression in transfected 293T cell line by SIRT3 monoclonal antibody. Lane 1: SIRT3 transfected lysate (Predicted MW: 28.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SIRT3 expression in transfected 293T cell line by SIRT3 monoclonal antibody. Lane 1: SIRT3 transfected lysate (Predicted MW: 28.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SIRT3 is 3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SIRT3 is 3ng/ml as a capture antibody.)
Product Categories/Family for anti-SIRT3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens sirtuin 3 (SIRT3), transcript variant 1, mRNA
NCBI Official Synonym Full Names
sirtuin 3
NCBI Official Symbol
SIRT3
NCBI Official Synonym Symbols
SIR2L3
NCBI Protein Information
NAD-dependent protein deacetylase sirtuin-3, mitochondrial
UniProt Protein Name
NAD-dependent protein deacetylase sirtuin-3, mitochondrial
UniProt Gene Name
SIRT3
UniProt Synonym Gene Names
SIR2L3; hSIRT3
UniProt Entry Name
SIR3_HUMAN

NCBI Description

SIRT3 encodes a member of the sirtuin family of class III histone deacetylases, homologs to the yeast Sir2 protein. The encoded protein is found exclusively in mitochondria, where it can eliminate reactive oxygen species, inhibit apoptosis, and prevent the formation of cancer cells. SIRT3 has far-reaching effects on nuclear gene expression, cancer, cardiovascular disease, neuroprotection, aging, and metabolic control. [provided by RefSeq, May 2019]

Uniprot Description

SIRT3: a soluble mitochondrial NAD-dependent protein deacetylase. Can deacetylate and thereby activate a central metabolic regulator in the mitochondrial matrix, glutamate dehydrogenase. Mitochondrial proteins are hyperacetylated in SIRT3-deficient mice, but not in SIRT4 or SIRT5 deficient mice. SIRT3-deficient mice have no obvious metabolic phenotype, and the process of adaptive thermogenesis is normal. Can deacetylate and activate isocitrate dehydrogenase 2, an enzyme that participates in regulation of the citric acid cycle and the regeneration of antioxidants. Inhibited by nicotinamide, but not by trichostatin A. Its unprocessed form is enzymatically inactive. It is processed by mitochondrial processing peptidase (MPP) in the mitochondrial matrix to give an enzymatically active 28 kDa product.

Protein type: Deacetylase; EC 3.5.1.-; Mitochondrial

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: mitochondrion; membrane; mitochondrial matrix

Molecular Function: protein binding; enzyme binding; zinc ion binding; NAD-dependent histone deacetylase activity (H3-K14 specific); NAD+ ADP-ribosyltransferase activity

Biological Process: mitochondrion organization and biogenesis; protein amino acid ADP-ribosylation; protein amino acid deacetylation; organelle organization and biogenesis; aerobic respiration; aging

Research Articles on SIRT3

Similar Products

Product Notes

The SIRT3 sirt3 (Catalog #AAA6154972) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Sirtuin 3 (SIRT3, hSIRT3, NAD-dependent Protein Deacetylase Sirtuin-3, Mitochondrial, Regulatory Protein SIR2 Homolog 3, SIR2-like Protein 3, SIR2L3) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Sirtuin 3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SIRT3 sirt3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Sirtuin 3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.