Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human SIK2 Monoclonal Antibody | anti-SIK2 antibody

SIK2 (Salt-inducible Kinase 2, Serine/threonine-protein Kinase SIK2, SIK-2, KIAA0781, Qin-induced Kinase, QIK, Serine/threonine-protein Kinase SNF1-like Kinase 2, SNF1LK2, LOH11CR1I) (AP)

Gene Names
SIK2; QIK; SIK-2; SNF1LK2; LOH11CR1I
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SIK2; Monoclonal Antibody; SIK2 (Salt-inducible Kinase 2; Serine/threonine-protein Kinase SIK2; SIK-2; KIAA0781; Qin-induced Kinase; QIK; Serine/threonine-protein Kinase SNF1-like Kinase 2; SNF1LK2; LOH11CR1I) (AP); EC=2.7.11.1; anti-SIK2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H6
Specificity
Recognizes human SNF1LK2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
9622
Applicable Applications for anti-SIK2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa467-577 from SNF1LK2 (NP_056006) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
AHAFEAFQSTRSGQRRHTLSEVTNQLVVMPGAGKIFSMNDSPSLDSVDSEYDMGSVQRDLNFLEDNPSLKDIMLANQPSPRMTSPFISLRPTNPAMQALSSQKREVHNRS*
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)
Product Categories/Family for anti-SIK2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens salt inducible kinase 2 (SIK2), mRNA
NCBI Official Synonym Full Names
salt inducible kinase 2
NCBI Official Symbol
SIK2
NCBI Official Synonym Symbols
QIK; SIK-2; SNF1LK2; LOH11CR1I
NCBI Protein Information
serine/threonine-protein kinase SIK2
UniProt Protein Name
Serine/threonine-protein kinase SIK2
UniProt Gene Name
SIK2
UniProt Synonym Gene Names
; SIK-2
UniProt Entry Name
SIK2_HUMAN

Uniprot Description

QIK: a serine/threonine kinase of the CAMKL family and related to AMPK. Specifically expressed in adipose tissues. Like AMPK, QIK is phosphorylated and activated by LKB1. Part of a molecular complex including TORC2 and calcineurin that regulates the effects of circulating glucose and gut hormones during feeding on TORC2-mediated gene expression. In mice, insulin promotes the phosphorylation and ubiquitin-dependent degradation of TORC2, inhibiting gluconeogenic gene expression during re-feeding. In response to insulin, Akt2 phosphorylates and activates QIK which in turn stimulates the phosphorylation and cytoplasmic translocation of TORC2 where it associates with COP1, which promotes its ubiquitination and proteasomal degradation. Phosphorylates Ser794 of IRS1 in insulin-stimulated adipocytes, potentially modulating the efficiency of insulin signal transduction. Inhibits CREB activity by phosphorylating and repressing the CREB-specific coactivators, CRTC1-3.

Protein type: EC 2.7.11.1; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; Protein kinase, CAMK; CAMK group; CAMKL family; QIK subfamily

Chromosomal Location of Human Ortholog: 11q23.1

Cellular Component: cytoplasm; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; magnesium ion binding; ATP binding

Biological Process: regulation of insulin receptor signaling pathway; protein amino acid autophosphorylation; insulin receptor signaling pathway; protein amino acid phosphorylation

Research Articles on SIK2

Similar Products

Product Notes

The SIK2 sik2 (Catalog #AAA6133893) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SIK2 (Salt-inducible Kinase 2, Serine/threonine-protein Kinase SIK2, SIK-2, KIAA0781, Qin-induced Kinase, QIK, Serine/threonine-protein Kinase SNF1-like Kinase 2, SNF1LK2, LOH11CR1I) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SIK2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SIK2 sik2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SIK2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.