Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen using MBS6001946 (36.34kD).)

Mouse anti-Human Siglec 12 Monoclonal Antibody | anti-SIGLEC12 antibody

Siglec 12 (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Siglec XII, S2V, Sialic Acid-binding Ig-like Lectin-like 1, Siglec L1, Siglec L1, SLG, UNQ9215/PRO34042) (MaxLight 750)

Gene Names
SIGLEC12; S2V; SLG; SIGLECL1; Siglec-XII
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Siglec 12; Monoclonal Antibody; Siglec 12 (Sialic Acid-binding Ig-like Lectin 12; Siglec XII; S2V; Sialic Acid-binding Ig-like Lectin-like 1; Siglec L1; SLG; UNQ9215/PRO34042) (MaxLight 750); anti-SIGLEC12 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D1
Specificity
Recognizes human SIGLEC12.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Concentration
1mg/mL (varies by lot)
Sequence
RSCRKKSARPAVGVGDTGMEDANAVRGSASQGPLIESPADDSPPHHAPPALATPSPEEGEIQYASLSFHKARPQYPQEQEAIGYEYSEINIPK
Applicable Applications for anti-SIGLEC12 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa503-595 from human SIGLEC12 with GST tag. MW of the GST tag alone is 26kD.
Conjugate
MaxLight750
Grade
Affinity Purified
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen using MBS6001946 (36.34kD).)

Western Blot (WB) (Western Blot detection against Immunogen using MBS6001946 (36.34kD).)

Testing Data

(Detection limit for recombinant GST tagged is 0.3ng/ml using MBS6001946 as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged is 0.3ng/ml using MBS6001946 as a capture antibody.)
Related Product Information for anti-SIGLEC12 antibody
MaxLight750 is a new Near IR stable dye conjugate comparable to DyLight750, Alexa Fluor700 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (759nm); Emission (780nm); Extinction Coefficient 240,000.
Product Categories/Family for anti-SIGLEC12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64,984 Da
NCBI Official Full Name
sialic acid-binding Ig-like lectin 12 isoform a
NCBI Official Synonym Full Names
sialic acid binding Ig-like lectin 12 (gene/pseudogene)
NCBI Official Symbol
SIGLEC12
NCBI Official Synonym Symbols
S2V; SLG; SIGLECL1; Siglec-XII
NCBI Protein Information
sialic acid-binding Ig-like lectin 12; SIGLEC-like 1; sialic acid-binding Ig-like lectin-like 1
UniProt Protein Name
Sialic acid-binding Ig-like lectin 12
UniProt Gene Name
SIGLEC12
UniProt Synonym Gene Names
SIGLECL1; SLG; Siglec-12; Siglec-L1
UniProt Entry Name
SIG12_HUMAN

NCBI Description

Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor. This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternatively spliced transcript variants encoding distinct isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

SIGLEC12: Putative adhesion molecule that mediates sialic-acid dependent binding to cells. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface. Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 19q13.4

Cellular Component: integral to membrane

Molecular Function: carbohydrate binding

Biological Process: cell adhesion

Research Articles on SIGLEC12

Similar Products

Product Notes

The SIGLEC12 siglec12 (Catalog #AAA6235315) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Siglec 12 (Sialic Acid-binding Ig-like Lectin 12, Siglec 12, Siglec XII, S2V, Sialic Acid-binding Ig-like Lectin-like 1, Siglec L1, Siglec L1, SLG, UNQ9215/PRO34042) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Siglec 12 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SIGLEC12 siglec12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RSCRKKSARP AVGVGDTGME DANAVRGSAS QGPLIESPAD DSPPHHAPPA LATPSPEEGE IQYASLSFHK ARPQYPQEQE AIGYEYSEIN IPK. It is sometimes possible for the material contained within the vial of "Siglec 12, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.