Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human Sideroflexin 3 Monoclonal Antibody | anti-SFXN3 antibody

Sideroflexin 3 (Sideroflexin-3, SFXN3, SFX3, BA108L7.2)

Gene Names
SFXN3; SFX3; BA108L7.2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
Sideroflexin 3; Monoclonal Antibody; Sideroflexin 3 (Sideroflexin-3; SFXN3; SFX3; BA108L7.2); Anti -Sideroflexin 3 (Sideroflexin-3; anti-SFXN3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b, k
Clone Number
4A3
Specificity
Recognizes human SFXN3.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.4.
Concentration
0.5mg/ml (varies by lot)
Sequence
MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQV
Applicable Applications for anti-SFXN3 antibody
ELISA, Western Blot (WB)
Application Notes
ELISA: 1ng/ml
Optimal dilutions to be determined by the researcher.
Immunogen
Partial recombinant corresponding to aa1-100 from human SFXN3 (AAH00124) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of SFXN3 expression in Hela NE.)

Western Blot (WB) (Western Blot analysis of SFXN3 expression in Hela NE.)

Western Blot (WB)

(Western Blot analysis of SFXN3 expression in transfected 293T cell line by 133247|Lane 1: SFXN3 transfected lysate (35.5kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SFXN3 expression in transfected 293T cell line by 133247|Lane 1: SFXN3 transfected lysate (35.5kD).|Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged SFXN3 is 1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SFXN3 is 1ng/ml as a capture antibody.)
Product Categories/Family for anti-SFXN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
35,979 Da
NCBI Official Full Name
sideroflexin 3
NCBI Official Synonym Full Names
sideroflexin 3
NCBI Official Symbol
SFXN3
NCBI Official Synonym Symbols
SFX3; BA108L7.2
NCBI Protein Information
sideroflexin-3
UniProt Protein Name
Sideroflexin-3
Protein Family
UniProt Gene Name
SFXN3
UniProt Entry Name
SFXN3_HUMAN

Uniprot Description

SFXN3: Potential iron transporter. Belongs to the sideroflexin family.

Protein type: Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 10q24.31

Cellular Component: mitochondrion; mitochondrial membrane; integral to membrane

Molecular Function: ion transmembrane transporter activity

Biological Process: iron ion homeostasis

Research Articles on SFXN3

Similar Products

Product Notes

The SFXN3 sfxn3 (Catalog #AAA6003897) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Sideroflexin 3 (Sideroflexin-3, SFXN3, SFX3, BA108L7.2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Sideroflexin 3 can be used in a range of immunoassay formats including, but not limited to, ELISA, Western Blot (WB). ELISA: 1ng/ml Optimal dilutions to be determined by the researcher. Researchers should empirically determine the suitability of the SFXN3 sfxn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MESKMGELPL DINIQEPRWD QSTFLGRARH FFTVTDPRNL LLSGAQLEAS RNIVQNYRAG VVTPGITEDQ LWRAKYVYDS AFHPDTGEKV VLIGRMSAQV. It is sometimes possible for the material contained within the vial of "Sideroflexin 3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.