Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human, Rat SH3MD2 Monoclonal Antibody | anti-sh3rf1 antibody

SH3MD2 (SH3RF1, Putative E3 Ubiquitin-protein Ligase SH3RF1, SH3 Domain-containing RING Finger Protein 1, Plenty of SH3s, Protein POSH, SH3 Multiple Domains Protein 2, RING Finger Protein 142, KIAA1494, POSH, RNF142)

Gene Names
sh3rf1; posh; xPOSH; rnf142; sh3md2
Reactivity
Human, Rat
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
SH3MD2; Monoclonal Antibody; SH3MD2 (SH3RF1; Putative E3 Ubiquitin-protein Ligase SH3RF1; SH3 Domain-containing RING Finger Protein 1; Plenty of SH3s; Protein POSH; SH3 Multiple Domains Protein 2; RING Finger Protein 142; KIAA1494; POSH; RNF142); Anti -SH3MD2 (SH3RF1; anti-sh3rf1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H3
Specificity
Recognizes human SH3MD2. Species Crossreactivity: rat.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
LAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSYPPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI
Applicable Applications for anti-sh3rf1 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa790-889 from human SH3MD2 (NP_065921) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(SH3MD2 monoclonal antibody, Western Blot analysis of SH3MD2 expression in HeLa.)

Western Blot (WB) (SH3MD2 monoclonal antibody, Western Blot analysis of SH3MD2 expression in HeLa.)

Western Blot (WB)

(SH3MD2 monoclonal antibody. Western Blot analysis of SH3MD2 expression in PC-12.)

Western Blot (WB) (SH3MD2 monoclonal antibody. Western Blot analysis of SH3MD2 expression in PC-12.)

Testing Data

(Detection limit for recombinant GST tagged SH3MD2 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SH3MD2 is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-sh3rf1 antibody
This gene encodes a protein containing an N-terminus RING-finger, four SH3 domains, and a region implicated in binding of the Rho GTPase Rac. Via the RING-finger, the encoded protein has been shown to function as an ubiquitin-protein ligase involved in protein sorting at the trans-Golgi network. The encoded protein may also act as a scaffold for the c-Jun N-terminal kinase signaling pathway, facilitating the formation of a functional signaling module. [provided by RefSeq]
Product Categories/Family for anti-sh3rf1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
91,754 Da
NCBI Official Full Name
sh3md2 protein
NCBI Official Synonym Full Names
SH3 domain containing ring finger 1
NCBI Official Symbol
sh3rf1
NCBI Official Synonym Symbols
posh; xPOSH; rnf142; sh3md2
NCBI Protein Information
E3 ubiquitin-protein ligase SH3RF1; plenty of SH3s; SH3 domain-containing RING finger protein 1; putative E3 ubiquitin-protein ligase SH3RF1
UniProt Protein Name
E3 ubiquitin-protein ligase SH3RF1
UniProt Gene Name
sh3rf1
UniProt Synonym Gene Names
posh; Protein POSH
UniProt Entry Name
SH3R1_XENTR

Uniprot Description

Function: Acts as a scaffold protein, contributes to Rac-induced signal transduction such as JNKs (mapk8 and mapk9) activation and induces apoptosis. Within a signaling complex, it probably recruits protein kinases such as map3k10 or map3k11 which are in turn activated leading to the sequential activation of map2k4, map2k7 and JNKs (mapk8 and mapk9)

By similarity. Plays an essential role in the anterior neural development.Might act as an E3 ubiquitin-protein ligase, or as part of E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes such as ube2d1 or ube2n and then transfers it to substrates. In the absence of an external substrate, it can catalyze self-ubiquitination

By similarity.

Pathway: Protein modification; protein ubiquitination.

Subcellular location: Cytoplasm › perinuclear region

By similarity. Cell projection › lamellipodium

By similarity. Golgi apparatus › trans-Golgi network

By similarity.

Domain: The RING finger domain is responsible of ubiquitination and proteasomal degradation.

Post-translational modification: Subject to ubiquitination and proteasomal degradation

By similarity.

Sequence similarities: Belongs to the SH3RF family.Contains 1 RING-type zinc finger.Contains 4 SH3 domains.

Similar Products

Product Notes

The sh3rf1 sh3rf1 (Catalog #AAA6004503) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SH3MD2 (SH3RF1, Putative E3 Ubiquitin-protein Ligase SH3RF1, SH3 Domain-containing RING Finger Protein 1, Plenty of SH3s, Protein POSH, SH3 Multiple Domains Protein 2, RING Finger Protein 142, KIAA1494, POSH, RNF142) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's SH3MD2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the sh3rf1 sh3rf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LAQDAFHRKA SSLDSAVPIA PPPRQACSSL GPVLNESRPV VCERHRVVVS YPPQSEAELE LKEGDIVFVH KKREDGWFKG TLQRNGKTGL FPGSFVENI. It is sometimes possible for the material contained within the vial of "SH3MD2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.