Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human, Mouse SH3D19 Monoclonal Antibody | anti-SH3D19 antibody

SH3D19 (SH3 Domain-containing Protein 19, ADAM-binding Protein Eve-1, EVE1, EEN-binding Protein, EBP, Kryn) (HRP)

Gene Names
SH3D19; EBP; EVE1; Kryn; Eve-1; SH3P19
Reactivity
Human, Mouse
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SH3D19; Monoclonal Antibody; SH3D19 (SH3 Domain-containing Protein 19; ADAM-binding Protein Eve-1; EVE1; EEN-binding Protein; EBP; Kryn) (HRP); anti-SH3D19 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse
Clonality
Monoclonal
Isotype
IgG3,k
Clone Number
5C7
Specificity
Recognizes human SH3D19. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SH3D19 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa94-204 from human SH3D19 (NP_001009555) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PVTKPELPKKPNPGLIRSVNPEIPGRGPLAESSDSGKKVPTPAPRPLLLKKSVSSENPTYPSAPLKPVTVPPRLAGASQAKAYKSLGEGPPANPPVPVLQSKPLVDIDLI
Conjugate
HRP
Preparation and Storage
May be stored at 4 degree C. For long-term storage, aliquot and store at 4 degree C. Do not freeze. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial prior to removing the cap. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(SH3D19 monoclonal antibody, Western Blot analysis of SH3D19 expression in HeLa.)

Western Blot (WB) (SH3D19 monoclonal antibody, Western Blot analysis of SH3D19 expression in HeLa.)

Western Blot (WB)

(SH3D19 monoclonal antibody. Western Blot analysis of SH3D19 expression in Raw 264.7.)

Western Blot (WB) (SH3D19 monoclonal antibody. Western Blot analysis of SH3D19 expression in Raw 264.7.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SH3D19 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SH3D19 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SH3D19 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to SH3D19 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-SH3D19 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
87kDa
NCBI Official Full Name
SH3 domain-containing protein 19 isoform 1
NCBI Official Synonym Full Names
SH3 domain containing 19
NCBI Official Symbol
SH3D19
NCBI Official Synonym Symbols
EBP; EVE1; Kryn; Eve-1; SH3P19
NCBI Protein Information
SH3 domain-containing protein 19

NCBI Description

This gene encodes a multiple SH3 domain-containing protein, which interacts with other proteins, such as EBP and members of ADAM family, via the SH3 domains. This protein may be involved in suppression of Ras-induced cellular transformation and Ras-mediated activation of ELK1 by EBP, and regulation of ADAM proteins in the signaling of EGFR-ligand shedding. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2011]

Research Articles on SH3D19

Similar Products

Product Notes

The SH3D19 (Catalog #AAA6154945) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SH3D19 (SH3 Domain-containing Protein 19, ADAM-binding Protein Eve-1, EVE1, EEN-binding Protein, EBP, Kryn) (HRP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's SH3D19 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SH3D19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SH3D19, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.