Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Mouse anti-Human SH2D3C Monoclonal Antibody | anti-SH2D3C antibody

SH2D3C (SH2 Domain-Containing Protein 3C, Novel SH2-Containing Protein 3, NSP3, UNQ272/PRO309/PRO34088) (PE)

Gene Names
SH2D3C; CHAT; NSP3; SHEP1; PRO34088
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SH2D3C; Monoclonal Antibody; SH2D3C (SH2 Domain-Containing Protein 3C; Novel SH2-Containing Protein 3; NSP3; UNQ272/PRO309/PRO34088) (PE); anti-SH2D3C antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3B2
Specificity
Recognizes human SH2D3C.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
2606
Applicable Applications for anti-SH2D3C antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-110 from SH2D3C (NP_005480) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MTAVGRRCPALGSRGAAGEPEAGSDYVKFSKEKYILDSSPEKLHKELEEELKLSSTDLRSHAWYHGRIPREVSETLVQRNGDFLIRDSLTSLGDYVLTCRWRNQALHFKI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(SH2D3C monoclonal antibody Western Blot analysis of SH2D3C expression in HeLa NE)

Western Blot (WB) (SH2D3C monoclonal antibody Western Blot analysis of SH2D3C expression in HeLa NE)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to SH2D3C on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to SH2D3C on formalin-fixed paraffin-embedded human lymph node. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SH2D3C is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SH2D3C is ~0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-SH2D3C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
Homo sapiens SH2 domain containing 3C (SH2D3C), transcript variant 2, mRNA
NCBI Official Synonym Full Names
SH2 domain containing 3C
NCBI Official Symbol
SH2D3C
NCBI Official Synonym Symbols
CHAT; NSP3; SHEP1; PRO34088
NCBI Protein Information
SH2 domain-containing protein 3C

NCBI Description

This gene encodes an adaptor protein and member of a cytoplasmic protein family involved in cell migration. The encoded protein contains a putative Src homology 2 (SH2) domain and guanine nucleotide exchange factor-like domain which allows this signaling protein to form a complex with scaffolding protein Crk-associated substrate. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]

Research Articles on SH2D3C

Similar Products

Product Notes

The SH2D3C (Catalog #AAA6160241) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SH2D3C (SH2 Domain-Containing Protein 3C, Novel SH2-Containing Protein 3, NSP3, UNQ272/PRO309/PRO34088) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SH2D3C can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SH2D3C for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SH2D3C, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.