Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (58.23kD).)

Mouse anti-Human SGOL1 Monoclonal Antibody | anti-SGOL1 antibody

SGOL1 (Shugoshin-like 1, SGO1, SGO, hSgo1, Serologically Defined Breast Cancer Antigen NY-BR-85) APC

Gene Names
SGO1; SGO; CAID; SGOL1; NY-BR-85
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SGOL1; Monoclonal Antibody; SGOL1 (Shugoshin-like 1; SGO1; SGO; hSgo1; Serologically Defined Breast Cancer Antigen NY-BR-85) APC; anti-SGOL1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C11
Specificity
Recognizes human SGOL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1564
Applicable Applications for anti-SGOL1 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant protein corresponding to aa1-293 from human SGOL1 (AAH17867) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (58.23kD).)

Western Blot (WB) (Western Blot detection against Immunogen (58.23kD).)

Western Blot (WB)

(Western Blot analysis of SGOL1 expression in transfected 293T cell line by SGOL1 monoclonal antibody. Lane 1: SGOL1 transfected lysate (33.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SGOL1 expression in transfected 293T cell line by SGOL1 monoclonal antibody. Lane 1: SGOL1 transfected lysate (33.5kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of SGOL1 transfected lysate using SGOL1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SGOL1 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of SGOL1 transfected lysate using SGOL1 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with SGOL1 rabbit polyclonal antibody.)
Product Categories/Family for anti-SGOL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens shugoshin-like 1 (S. pombe), mRNA
NCBI Official Synonym Full Names
shugoshin 1
NCBI Official Symbol
SGO1
NCBI Official Synonym Symbols
SGO; CAID; SGOL1; NY-BR-85
NCBI Protein Information
shugoshin 1

NCBI Description

The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this gene leads to the premature loss of centromeric cohesion, mis-segregation of sister chromatids, and mitotic arrest. Evidence suggests that this protein also protects a small subset of cohesin found along the length of the chromosome arms during mitotic prophase. An isoform lacking exon 6 has been shown to play a role in the cohesion of centrioles (PMID: 16582621 and PMID:18331714). Mutations in this gene have been associated with Chronic Atrial and Intestinal Dysrhythmia (CAID) syndrome, characterized by the co-occurrence of Sick Sinus Syndrome (SSS) and Chronic Intestinal Pseudo-obstruction (CIPO) within the first four decades of life (PMID:25282101). Fibroblast cells from CAID patients exhibited both increased cell proliferation and higher rates of senescence. Pseudogenes of this gene have been found on chromosomes 1 and 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]

Research Articles on SGOL1

Similar Products

Product Notes

The SGOL1 (Catalog #AAA6139023) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SGOL1 (Shugoshin-like 1, SGO1, SGO, hSgo1, Serologically Defined Breast Cancer Antigen NY-BR-85) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SGOL1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SGOL1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGOL1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.