Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of SGOL1 expression in transfected 293T cell line by SGOL1 polyclonal antibody. Lane 1: SGOL1 transfected lysate (33.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human SGOL1 Polyclonal Antibody | anti-SGOL1 antibody

SGOL1 (Shugoshin-like 1, SGO1, SGO, hSgo1, Serologically Defined Breast Cancer Antigen NY-BR-85) (AP)

Gene Names
SGO1; SGO; CAID; SGOL1; NY-BR-85
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SGOL1; Polyclonal Antibody; SGOL1 (Shugoshin-like 1; SGO1; SGO; hSgo1; Serologically Defined Breast Cancer Antigen NY-BR-85) (AP); anti-SGOL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human SGOL1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
292
Applicable Applications for anti-SGOL1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human SGOL1, aa1-292 (NP_612493.1).
Immunogen Sequence
MAKERCLKKSFQDSLEDIKKRMKEKRNKNLAEIGKRRSFIAAPCQIITNTSTLLKNYQDNNKMLVLALENEKSKVKEAQDIILQLRKECYYLTCQLYALKGKLTSQQTVEPAQNQEICSSGMDPNSDDSSRNLFVKDLPQIPLEETELPGQGESFQIEATPPETQQSPHLSLKDITNVSLYPVVKIRRLSLSPKKNKASPAVALPKRRCTASVNYKEPTLASKLRRGDPFTDLCFLNSPIFKQKKDLRRSKKRALEVSPAKEAIFILYYVREFVSRFPDCRKCKLETHICLR
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of SGOL1 expression in transfected 293T cell line by SGOL1 polyclonal antibody. Lane 1: SGOL1 transfected lysate (33.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of SGOL1 expression in transfected 293T cell line by SGOL1 polyclonal antibody. Lane 1: SGOL1 transfected lysate (33.5kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-SGOL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
shugoshin 1 isoform 1KL
NCBI Official Synonym Full Names
shugoshin 1
NCBI Official Symbol
SGO1
NCBI Official Synonym Symbols
SGO; CAID; SGOL1; NY-BR-85
NCBI Protein Information
shugoshin 1
UniProt Protein Name
Shugoshin-like 1
UniProt Gene Name
SGOL1
UniProt Synonym Gene Names
SGO1; hSgo1
UniProt Entry Name
SGOL1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the shugoshin family of proteins. This protein is thought to protect centromeric cohesin from cleavage during mitotic prophase by preventing phosphorylation of a cohesin subunit. Reduced expression of this gene leads to the premature loss of centromeric cohesion, mis-segregation of sister chromatids, and mitotic arrest. Evidence suggests that this protein also protects a small subset of cohesin found along the length of the chromosome arms during mitotic prophase. An isoform lacking exon 6 has been shown to play a role in the cohesion of centrioles (PMID: 16582621 and PMID:18331714). Mutations in this gene have been associated with Chronic Atrial and Intestinal Dysrhythmia (CAID) syndrome, characterized by the co-occurrence of Sick Sinus Syndrome (SSS) and Chronic Intestinal Pseudo-obstruction (CIPO) within the first four decades of life (PMID:25282101). Fibroblast cells from CAID patients exhibited both increased cell proliferation and higher rates of senescence. Pseudogenes of this gene have been found on chromosomes 1 and 7. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2015]

Uniprot Description

SGO1: Plays a central role in chromosome cohesion during mitosis by preventing premature dissociation of cohesin complex from centromeres after prophase, when most of cohesin complex dissociates from chromosomes arms. May act by preventing phosphorylation of the STAG2 subunit of cohesin complex at the centromere, ensuring cohesin persistence at centromere until cohesin cleavage by ESPL1/separase at anaphase. Essential for proper chromosome segregation during mitosis and this function requires interaction with PPP2R1A. Its phosphorylated form is necessary for chromosome congression and for the proper attachment of spindle microtubule to the kinetochore. Necessary for kinetochore localization of PLK1 and CENPF. May play a role in the tension sensing mechanism of the spindle-assembly checkpoint by regulating PLK1 kinetochore affinity. Isoform 3 plays a role in maintaining centriole cohesion involved in controlling spindle pole integrity. Belongs to the shugoshin family. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 3p24.3

Cellular Component: kinetochore; nucleoplasm; spindle pole; centrosome; cytoplasm; cytosol; condensed nuclear chromosome, pericentric region; chromosome, pericentric region

Molecular Function: protein binding; kinase binding

Biological Process: mitosis; cell division; mitotic cell cycle; attachment of spindle microtubules to kinetochore; centriole-centriole cohesion; meiotic chromosome segregation; chromosome segregation

Disease: Chronic Atrial And Intestinal Dysrhythmia

Research Articles on SGOL1

Similar Products

Product Notes

The SGOL1 sgol1 (Catalog #AAA6394014) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SGOL1 (Shugoshin-like 1, SGO1, SGO, hSgo1, Serologically Defined Breast Cancer Antigen NY-BR-85) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SGOL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SGOL1 sgol1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGOL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.