Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.8kD).)

Mouse anti-Human SGMS2 Monoclonal Antibody | anti-SGMS2 antibody

SGMS2 (SMS2, Phosphatidylcholine:ceramide Cholinephosphotransferase 2, Sphingomyelin Synthase 2, MGC26963) (PE)

Gene Names
SGMS2; SMS2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SGMS2; Monoclonal Antibody; SGMS2 (SMS2; Phosphatidylcholine:ceramide Cholinephosphotransferase 2; Sphingomyelin Synthase 2; MGC26963) (PE); anti-SGMS2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
7D10
Specificity
Recognizes human MGC26963.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-SGMS2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa2-81 from human MGC26963 (NP_689834) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKTG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.8kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.8kD).)

Western Blot (WB)

(Western Blot analysis of MGC26963 expression in transfected 293T cell line by MGC26963 monoclonal antibody. Lane 1: MGC26963 transfected lysate (42.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MGC26963 expression in transfected 293T cell line by MGC26963 monoclonal antibody. Lane 1: MGC26963 transfected lysate (42.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB)

(Western blot analysis of MGC26963 over-expressed 293 cell line, cotransfected with MGC26963 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MGC26963 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of MGC26963 over-expressed 293 cell line, cotransfected with MGC26963 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with MGC26963 monoclonal antibody. GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-SGMS2 antibody
Sphingomyelin, a major component of cell and Golgi membranes, is made by the transfer of phosphocholine from phosphatidylcholine onto ceramide, with diacylglycerol as a side product. The protein encoded by this gene is an enzyme that catalyzes this reaction primarily at the cell membrane. The synthesis is reversible, and this enzyme can catalyze the reaction in either direction. The encoded protein is required for cell growth. Three transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-SGMS2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42kDa
NCBI Official Full Name
phosphatidylcholine:ceramide cholinephosphotransferase 2
NCBI Official Synonym Full Names
sphingomyelin synthase 2
NCBI Official Symbol
SGMS2
NCBI Official Synonym Symbols
SMS2
NCBI Protein Information
phosphatidylcholine:ceramide cholinephosphotransferase 2
UniProt Protein Name
Phosphatidylcholine:ceramide cholinephosphotransferase 2
UniProt Gene Name
SGMS2
UniProt Synonym Gene Names
SMS2
UniProt Entry Name
SMS2_HUMAN

NCBI Description

Sphingomyelin, a major component of cell and Golgi membranes, is made by the transfer of phosphocholine from phosphatidylcholine onto ceramide, with diacylglycerol as a side product. The protein encoded by this gene is an enzyme that catalyzes this reaction primarily at the cell membrane. The synthesis is reversible, and this enzyme can catalyze the reaction in either direction. The encoded protein is required for cell growth. Three transcript variants encoding the same protein have been found for this gene. There is evidence for more variants, but the full-length nature of their transcripts has not been determined.[provided by RefSeq, Oct 2008]

Uniprot Description

SMS2: Sphingomyelin synthases synthesize the sphingolipid, sphingomyelin, through transfer of the phosphatidyl head group, phosphatidylcholine, on to the primary hydroxyl of ceramide. The reaction is bidirectional depending on the respective levels of the sphingolipid and ceramide. Plasma membrane SMS2 can also convert phosphatidylethanolamine (PE) to ceramide phosphatidylethanolamine (CPE). Major form in liver. Required for cell growth in certain cell types. Regulator of cell surface levels of ceramide, an important mediator of signal transduction and apoptosis. Regulation of sphingomyelin (SM) levels at the cell surface affects insulin sensitivity. Belongs to the sphingomyelin synthase family.

Protein type: Lipid Metabolism - sphingolipid; Transferase; Membrane protein, integral; Membrane protein, multi-pass; EC 2.7.8.27

Chromosomal Location of Human Ortholog: 4q25

Cellular Component: Golgi apparatus; integral to plasma membrane; plasma membrane; integral to Golgi membrane

Molecular Function: sphingomyelin synthase activity; kinase activity; ceramide cholinephosphotransferase activity

Biological Process: sphingolipid metabolic process; sphingolipid biosynthetic process; sphingomyelin biosynthetic process; phosphorylation

Research Articles on SGMS2

Similar Products

Product Notes

The SGMS2 sgms2 (Catalog #AAA6160234) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SGMS2 (SMS2, Phosphatidylcholine:ceramide Cholinephosphotransferase 2, Sphingomyelin Synthase 2, MGC26963) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SGMS2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SGMS2 sgms2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SGMS2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.