Mouse anti-Human SFTPC Monoclonal Antibody | anti-SFTPC antibody

SFTPC (SFTP2, Pulmonary Surfactant-associated Protein C, Pulmonary Surfactant-associated Proteolipid SPL(Val), SP5) APC

Cat. Num. AAA6139014

• Gene Names: SFTPC; SP-C; PSP-C; SFTP2; SMDP2; BRICD6
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SFTPC; Monoclonal Antibody; SFTPC (SFTP2; Pulmonary Surfactant-associated Protein C; Pulmonary Surfactant-associated Proteolipid SPL(Val); SP5) APC; anti-SFTPC antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4A10
• Specificity: Recognizes human SFTPC.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-SFTPC antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-198 from human SFTPC (AAH05913) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MDVGSKEVLMESPPDYSAAPRGRFGIPRCPVHLKRLLIVVVVVVLIVVVIVGALLMGLHMSQKHTEMVLEMSIGAPEAQQRLALSEHLVTTATFSIGSTGLVVYDYQQLLIAYKPAPGTCCYIMKIAPESIPSLEALNRKVHNFQMECSLQAKPAVPTSKLGQAEGRDAGSAPSGGDPAFLGMAVNTLCGEVPLYYI*
• Conjugate: APC
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (47.41kD).)

Testing Data

(Detection limit for recombinant GST tagged SFTPC is 0.3ng/ml as a capture antibody.)

Related Product Information for anti-SFTPC antibody

This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 2, also called pulmonary alveolar proteinosis due to surfactant protein C deficiency, and are associated with interstitial lung disease in older infants, children, and adults. Alternatively spliced transcript variants encoding different protein isoforms have been identified.

Product Categories/Family for anti-SFTPC antibody

Antibodies; Pulmonary Proteins

References

1. Identification of a bone marrow-derived epithelial-like population capable of repopulating injured mouse airway epithelium. Wong AP, Keating A, Lu WY, Duchesneau P, Wang X, Sacher A, Hu J, Waddell TK.J Clin Invest. 2009 Feb;119(2):336-48. doi: 10.1172/JCI36882. Epub 2009 Jan 26.

NCBI and Uniprot Product Information

• NCBI GI #: 13543508
• NCBI GeneID: 6440
• Molecular Weight: 20,361 Da
• NCBI Official Full Name: Homo sapiens surfactant protein C, mRNA
• NCBI Official Synonym Full Names: surfactant protein C
• NCBI Official Symbol: SFTPC
• NCBI Official Synonym Symbols: SP-C; PSP-C; SFTP2; SMDP2; BRICD6
• NCBI Protein Information: pulmonary surfactant-associated protein C
• Protein Family: Pulmonary surfactant-associated protein

NCBI Description

This gene encodes the pulmonary-associated surfactant protein C (SPC), an extremely hydrophobic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 2, also called pulmonary alveolar proteinosis due to surfactant protein C deficiency, and are associated with interstitial lung disease in older infants, children, and adults. Alternatively spliced transcript variants encoding different protein isoforms have been identified.[provided by RefSeq, Feb 2010]