Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SF3B3 is 0.1ng/ml as a capture antibody.)

Mouse anti-Human SF3B3 Monoclonal Antibody | anti-SF3B3 antibody

SF3B3 (Splicing Factor 3B Subunit 3, KIAA0017, Pre-mRNA-splicing Factor SF3b 130kD Subunit, SF3b130, STAF130, Spliceosome-associated Protein 130, SAP 130, SAP130) (HRP)

Gene Names
SF3B3; RSE1; SAP130; SF3b130; STAF130
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SF3B3; Monoclonal Antibody; SF3B3 (Splicing Factor 3B Subunit 3; KIAA0017; Pre-mRNA-splicing Factor SF3b 130kD Subunit; SF3b130; STAF130; Spliceosome-associated Protein 130; SAP 130; SAP130) (HRP); anti-SF3B3 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F1
Specificity
Recognizes human SF3B3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
9692
Applicable Applications for anti-SF3B3 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa819-930 from SF3B3 (NP_036558) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MAEEMVEAAGEDERELAAEMAAAFLNENLPESIFGAPKAGNGQWASVIRVMNPIQGNTLDLVQLEQNEAAFSVAVCRFSNTGEDWYVLVGVAKDLILNPRSVAGGFVYTYK*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SF3B3 is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SF3B3 is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-SF3B3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens splicing factor 3b subunit 3 (SF3B3), mRNA
NCBI Official Synonym Full Names
splicing factor 3b subunit 3
NCBI Official Symbol
SF3B3
NCBI Official Synonym Symbols
RSE1; SAP130; SF3b130; STAF130
NCBI Protein Information
splicing factor 3B subunit 3
UniProt Protein Name
Splicing factor 3B subunit 3
Protein Family
UniProt Gene Name
SF3B3
UniProt Synonym Gene Names
KIAA0017; SAP130; SF3b130; SAP 130
UniProt Entry Name
SF3B3_HUMAN

NCBI Description

This gene encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair. [provided by RefSeq, Jul 2008]

Uniprot Description

SF3B3: Subunit of the splicing factor SF3B required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA. May also be involved in the assembly of the 'E' complex. Belongs also to the minor U12-dependent spliceosome, which is involved in the splicing of rare class of nuclear pre-mRNA intron. Belongs to the RSE1 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding; RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: small nuclear ribonucleoprotein complex; nucleoplasm; spliceosome; U12-dependent spliceosome

Molecular Function: protein binding; RNA binding

Biological Process: RNA splicing, via transesterification reactions; nuclear mRNA splicing, via spliceosome; RNA splicing; protein complex assembly; gene expression; mRNA processing

Research Articles on SF3B3

Similar Products

Product Notes

The SF3B3 sf3b3 (Catalog #AAA6154915) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SF3B3 (Splicing Factor 3B Subunit 3, KIAA0017, Pre-mRNA-splicing Factor SF3b 130kD Subunit, SF3b130, STAF130, Spliceosome-associated Protein 130, SAP 130, SAP130) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SF3B3 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SF3B3 sf3b3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SF3B3, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.