Mouse anti-Human SERCA1 Monoclonal Antibody | anti-SERCA1 antibody

SERCA1 (ATP2A1, ATPase, Ca++ transporting, Cardiac Muscle, Fast Twitch 1, ATP2A, OTTHUMP00000162562, SR Ca(2+)-ATPase 1, Calcium pump 1, Calcium-transporting ATPase sarcoplasmic reticulum Type, Fast Twitch skeletal Muscle isoform, Endoplasmic Reticulum cl

Cat. Num. AAA6145549

• Gene Names: atp2a1; atp2a; atp2a2; serca1
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: SERCA1; Monoclonal Antibody; SERCA1 (ATP2A1; ATPase; Ca++ transporting; Cardiac Muscle; Fast Twitch 1; ATP2A; OTTHUMP00000162562; SR Ca(2+)-ATPase 1; Calcium pump 1; Calcium-transporting ATPase sarcoplasmic reticulum Type; Fast Twitch skeletal Muscle isoform; Endoplasmic Reticulum cl; anti-SERCA1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2C7
• Specificity: Recognizes human ATP2A1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SERCA1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Recombinant protein corresponding to aa522-612 from human ATP2A1 with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: IDRCNYVRVGTTRVPLTGPVKEKIMAVIKEWGTGRDTLRCLALATRDTPPKREEMVLDDSARFLEYETDLTFVGVVGMLDPPRKEVTGSIQ
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Related Product Information for anti-SERCA1 antibody

This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in muscular excitation and contraction. Mutations in this gene cause some autosomal recessive forms of Brody disease, characterized by increasing impairment of muscular relaxation during exercise. Alternative splicing results in two transcript variants encoding different isoforms.

Product Categories/Family for anti-SERCA1 antibody

Antibodies; Enzymes; ATPase

NCBI and Uniprot Product Information

• NCBI GI #: 147907326
• NCBI GeneID: 446229
• NCBI Accession #: NP_775293
• NCBI GenBank Nucleotide #: NM_001092974.1
• UniProt Accession #: O14983
• Molecular Weight: Calculated MW 110kDa
• NCBI Official Full Name: ATPase, Ca++ transporting, slow twitch 2
• NCBI Official Synonym Full Names: ATPase, Ca++ transporting, cardiac muscle, fast twitch 1<
• NCBI Official Symbol: atp2a1
• NCBI Official Synonym Symbols: atp2a; atp2a2; serca1
• NCBI Protein Information: ATPase, Ca++ transporting, slow twitch 2; ATPase, Ca++ transporting, slow twitch 2; ATPase, Ca++ transporting, cardiac muscle, slow twitch 2
• UniProt Protein Name: Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
• UniProt Gene Name: ATP2A1
• UniProt Synonym Gene Names: SERCA1
• UniProt Entry Name: AT2A1_HUMAN

Uniprot Description

ATP2A1: This magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen. Contributes to calcium sequestration involved in muscular excitation/contraction. Associated with sarcolipin (SLN) and phospholamban (PLN). Increased contractile activity leads to a decrease in SERCA1 expression, while decreased contractile activity leads to an increase in SERCA1 expression. Skeletal muscle, fast twitch muscle (type II) fibers. Reversibly inhibited by phospholamban (PLN) at low calcium concentrations. Dephosphorylated PLN decreases the apparent affinity of the ATPase for calcium. This inhibition is regulated by the phosphorylation of PLN. Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Endoplasmic reticulum; Hydrolase; Transporter, ion channel; EC 3.6.3.8; Transporter; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 16p12.1

Cellular Component: I band; endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; membrane; sarcoplasmic reticulum; perinuclear region of cytoplasm; integral to membrane; ER-Golgi intermediate compartment

Molecular Function: protein binding; protein homodimerization activity; calcium-transporting ATPase activity; calcium ion binding; ATP binding

Biological Process: apoptotic mitochondrial changes; positive regulation of fast-twitch skeletal muscle contraction; maintenance of mitochondrion localization; metabolic process; reduction of endoplasmic reticulum calcium ion concentration; calcium ion transport; elevation of endoplasmic reticulum calcium ion concentration; regulation of striated muscle contraction; blood coagulation; transmembrane transport; negative regulation of striated muscle contraction; elevation of mitochondrial calcium ion concentration

Disease: Brody Myopathy