Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human Semaphorin 4A Monoclonal Antibody | anti-SEMA4A antibody

Semaphorin 4A (Semaphorin-4A, SEMA4A, CORD10, RP35, RP11-54H19.2, Semaphorin-B, Sema B, SEMAB, SEMB, UNQ783/PRO1317) (MaxLight 405)

Gene Names
SEMA4A; RP35; SEMB; SEMAB; CORD10
Reactivity
Human
Applications
FLISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Semaphorin 4A; Monoclonal Antibody; Semaphorin 4A (Semaphorin-4A; SEMA4A; CORD10; RP35; RP11-54H19.2; Semaphorin-B; Sema B; SEMAB; SEMB; UNQ783/PRO1317) (MaxLight 405); anti-SEMA4A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4E2
Specificity
Recognizes human SEMA4A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Applicable Applications for anti-SEMA4A antibody
FLISA
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa33-132 from human SEMA4A with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GGGQGPMPRVRYYAGDERRALSFFHQKGLQDFDTLLLSGDGNTLYVGAREAILALDIQDPGVPRLKNMIPWPASDRKKSECAFKKKSNETQCFNFIRVLV
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-SEMA4A antibody
MaxLight405 is a new Violet photostable dye conjugate comparable to Alexa Fluor 405, PacificBlue, Brilliant Violet 421 and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (400nm); Emission (423nm); Extinction Coefficient 32,000.
Product Categories/Family for anti-SEMA4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84kDa
NCBI Official Full Name
semaphorin-4A isoform 1
NCBI Official Synonym Full Names
semaphorin 4A
NCBI Official Symbol
SEMA4A
NCBI Official Synonym Symbols
RP35; SEMB; SEMAB; CORD10
NCBI Protein Information
semaphorin-4A
UniProt Protein Name
Sema domain, immunoglobulin domain (Ig), transmembrane domain (TM) and short cytoplasmic domain, (Semaphorin) 4A
Protein Family
UniProt Gene Name
SEMA4A
UniProt Entry Name
Q5TCJ6_HUMAN

NCBI Description

This gene encodes a member of the semaphorin family of soluble and transmembrane proteins. Semaphorins are involved in numerous functions, including axon guidance, morphogenesis, carcinogenesis, and immunomodulation. The encoded protein is a single-pass type I membrane protein containing an immunoglobulin-like C2-type domain, a PSI domain and a sema domain. It inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. It is an activator of T-cell-mediated immunity and suppresses vascular endothelial growth factor (VEGF)-mediated endothelial cell migration and proliferation in vitro and angiogenesis in vivo. Mutations in this gene are associated with retinal degenerative diseases including retinitis pigmentosa type 35 (RP35) and cone-rod dystrophy type 10 (CORD10). Multiple alternatively spliced transcript variants encoding different isoforms have been identified.[provided by RefSeq, Sep 2010]

Uniprot Description

SEMA4A: a single-pass type I membrane protein that inhibits axonal extension by providing local signals to specify territories inaccessible for growing axons. Defects in SEMA4A are the cause of retinitis pigmentosa type 35 and cone-rod dystrophy type 10.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 1q22

Cellular Component: integral to membrane; plasma membrane

Molecular Function: protein binding; receptor activity

Biological Process: axon guidance; regulation of cell shape; negative regulation of angiogenesis; T-helper 1 cell differentiation; angiogenesis

Disease: Retinitis Pigmentosa 35; Cone-rod Dystrophy 10

Research Articles on SEMA4A

Similar Products

Product Notes

The SEMA4A sema4a (Catalog #AAA6192522) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Semaphorin 4A (Semaphorin-4A, SEMA4A, CORD10, RP35, RP11-54H19.2, Semaphorin-B, Sema B, SEMAB, SEMB, UNQ783/PRO1317) (MaxLight 405) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Semaphorin 4A can be used in a range of immunoassay formats including, but not limited to, FLISA. Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SEMA4A sema4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Semaphorin 4A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.