Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged SCN2B is ~0.03ng/ml as a capture antibody.)

Mouse anti-Human SCN2B Monoclonal Antibody | anti-SCN2B antibody

SCN2B (Sodium Channel Subunit beta-2, UNQ326/PRO386) (HRP)

Gene Names
SCN2B; ATFB14
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCN2B; Monoclonal Antibody; SCN2B (Sodium Channel Subunit beta-2; UNQ326/PRO386) (HRP); anti-SCN2B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G11-C12
Specificity
Recognizes human SCN2B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-SCN2B antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-216 from human SCN2B (AAH36793) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MHRDAWLPRPAFSLTGLSLFFSLVPPGRSMEVTVPATLNVLNGSDARLPCTFNSCYTVNHKQFSLNWTYQECNNCSEEMFLQFRMKIINLKLERFQDRVEFSGNPSKYDVSVMLRNVQPEDEGIYNCYIMNPPDRHRGHGKIHLQVLMEEPPERDSTVAVIVGASVGGFLAVVILVLMVVKCVRRKKEQKLSTDDLKTEEEGKTDGEGNPDDGAK*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged SCN2B is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SCN2B is ~0.03ng/ml as a capture antibody.)
Related Product Information for anti-SCN2B antibody
Scn2b encodes one type of beta subunit found in voltage-gated sodium channels. These channels, composed of one alpha and one or two different beta subunits, mediate changes in cell permeability to sodium ions that are essential for the generation of action potentials. Scn2b protein, comprised of an extracellular N-terminus with an immunoglobulin-like fold and a single transmembrane domain, has been shown in brain tissues to be covalently linked through disulfide bonds to the alpha subunit. Scn2b is considered an auxiliary subunit that modulates cell-surface expression and gating, though its function in heart myocytes may be limited to cell adhesion. Scnb2 null mice display increased susceptibility to seizures. Expression of Scn2b has been shown to be suppressed with exposure to pneumococcal acute otitis media.
Product Categories/Family for anti-SCN2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
24,326 Da
NCBI Official Full Name
Homo sapiens sodium channel, voltage-gated, type II, beta, mRNA
NCBI Official Synonym Full Names
sodium voltage-gated channel beta subunit 2
NCBI Official Symbol
SCN2B
NCBI Official Synonym Symbols
ATFB14
NCBI Protein Information
sodium channel subunit beta-2
Protein Family

NCBI Description

The protein encoded by this gene is the beta 2 subunit of the type II voltage-gated sodium channel. The encoded protein is involved in cell-cell adhesion and cell migration. Defects in this gene can be a cause of Brugada Syndrome, atrial fibrillation, or sudden infant death syndrome. [provided by RefSeq, Jul 2015]

Research Articles on SCN2B

Similar Products

Product Notes

The SCN2B (Catalog #AAA6154842) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCN2B (Sodium Channel Subunit beta-2, UNQ326/PRO386) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCN2B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCN2B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCN2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.