Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (33.37kD).)

Mouse anti-Human SCN11A Monoclonal Antibody | anti-SCN11A antibody

SCN11A (Sodium Channel Protein Type 11 Subunit alpha, NaN, hNaN, Nav1.9, Peripheral Nerve Sodium Channel 5, PN5, SCN12A, Sensory Neuron Sodium Channel 2, SNS2, SNS-2, Sodium Channel Protein Type XI Subunit alpha, Voltage-gated Sodium Channel Subunit alpha

Gene Names
SCN11A; NaN; PN5; FEPS3; HSAN7; SNS-2; NAV1.9; SCN12A
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SCN11A; Monoclonal Antibody; SCN11A (Sodium Channel Protein Type 11 Subunit alpha; NaN; hNaN; Nav1.9; Peripheral Nerve Sodium Channel 5; PN5; SCN12A; Sensory Neuron Sodium Channel 2; SNS2; SNS-2; Sodium Channel Protein Type XI Subunit alpha; Voltage-gated Sodium Channel Subunit alpha; anti-SCN11A antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6E1
Specificity
Recognizes human SCN11A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
6505
Applicable Applications for anti-SCN11A antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1726-1792 from SCN11A (NP_054858) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TTTKRKEEERGAAIIQKAFRKYMMKVTKGDQGDQNDLENGPHSPLQTLCNGDLSSFGVAKGKVHCD*
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (33.37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (33.37kD).)

Testing Data

(Detection limit for recombinant GST tagged SCN11A is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged SCN11A is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-SCN11A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens sodium voltage-gated channel alpha subunit 11 (SCN11A), transcript variant 1, mRNA
NCBI Official Synonym Full Names
sodium voltage-gated channel alpha subunit 11
NCBI Official Symbol
SCN11A
NCBI Official Synonym Symbols
NaN; PN5; FEPS3; HSAN7; SNS-2; NAV1.9; SCN12A
NCBI Protein Information
sodium channel protein type 11 subunit alpha
UniProt Protein Name
Sodium channel protein type 11 subunit alpha
Protein Family
UniProt Gene Name
SCN11A
UniProt Synonym Gene Names
SCN12A; SNS2; PN5
UniProt Entry Name
SCNBA_HUMAN

NCBI Description

Voltage-gated sodium channels are transmembrane glycoprotein complexes composed of a large alpha subunit with 24 transmembrane domains and one or more regulatory beta subunits. They are responsible for the generation and propagation of action potentials in neurons and muscle. This gene encodes one member of the sodium channel alpha subunit gene family, and is highly expressed in nociceptive neurons of dorsal root ganglia and trigeminal ganglia. It mediates brain-derived neurotrophic factor-evoked membrane depolarization and is a major effector of peripheral inflammatory pain hypersensitivity. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy type VII and familial episodic pain syndrome-3. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2017]

Uniprot Description

Function: This protein mediates the voltage-dependent sodium ion permeability of excitable membranes. Assuming opened or closed conformations in response to the voltage difference across the membrane, the protein forms a sodium-selective channel through which sodium ions may pass in accordance with their electrochemical gradient. It is a tetrodotoxin-resistant sodium channel isoform. Also involved, with the contribution of the receptor tyrosine kinase NTRK2, in rapid BDNF-evoked neuronal depolarization. Ref.1 Ref.3

Subunit structure: The voltage-resistant sodium channel consists of an ion conducting pore forming alpha-subunit regulated by one or more auxiliary subunits SCN1B, SCN2B and SCN3B.

Subcellular location: Membrane; Multi-pass membrane protein

By similarity.

Tissue specificity: Expressed in the dorsal root ganglia and trigeminal ganglia, olfactory bulb, hippocampus, cerebellar cortex, spinal cord, spleen, small intestine and placenta. Ref.2 Ref.5

Domain: The sequence contains 4 internal repeats, each with 5 hydrophobic segments (S1,S2,S3,S5,S6) and one positively charged segment (S4). Segments S4 are probably the voltage-sensors and are characterized by a series of positively charged amino acids at every third position.

Post-translational modification: Phosphorylation at Ser-1341 by PKC in a highly conserved cytoplasmic loop slows inactivation of the sodium channel and reduces peak sodium currents

By similarity.

Sequence similarities: Belongs to the sodium channel (TC 1.A.1.10) family. Nav1.9/SCN11A subfamily. [View classification]

Research Articles on SCN11A

Similar Products

Product Notes

The SCN11A scn11a (Catalog #AAA6144235) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SCN11A (Sodium Channel Protein Type 11 Subunit alpha, NaN, hNaN, Nav1.9, Peripheral Nerve Sodium Channel 5, PN5, SCN12A, Sensory Neuron Sodium Channel 2, SNS2, SNS-2, Sodium Channel Protein Type XI Subunit alpha, Voltage-gated Sodium Channel Subunit alpha reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SCN11A can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SCN11A scn11a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SCN11A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.