Mouse anti-Human SAP18 Monoclonal Antibody | anti-SAP18 antibody

SAP18 (Histone Deacetylase Complex Subunit SAP18, 18kD Sin3-associated Polypeptide, 2HOR0202, Cell Growth-inhibiting Gene 38 Protein, Sin3-associated Polypeptide p18) (Biotin)

Cat. Num. AAA6144210

• Gene Names: SAP18; SAP18P; 2HOR0202
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: SAP18; Monoclonal Antibody; SAP18 (Histone Deacetylase Complex Subunit SAP18; 18kD Sin3-associated Polypeptide; 2HOR0202; Cell Growth-inhibiting Gene 38 Protein; Sin3-associated Polypeptide p18) (Biotin); anti-SAP18 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3B2
• Specificity: Recognizes human SAP18.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-SAP18 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-153 from SAP18 (AAH30836) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDVKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPTSGRMRPY
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (42.94kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to SAP18 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged SAP18 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-SAP18 antibody

Antibodies; Histones

NCBI and Uniprot Product Information

• NCBI GI #: 21410830
• NCBI GeneID: 10284
• Molecular Weight: 17,561 Da
• NCBI Official Full Name: Homo sapiens Sin3A-associated protein, 18kDa, mRNA
• NCBI Official Synonym Full Names: Sin3A associated protein 18
• NCBI Official Symbol: SAP18
• NCBI Official Synonym Symbols: SAP18P; 2HOR0202
• NCBI Protein Information: histone deacetylase complex subunit SAP18
• Protein Family: Zinc finger A20 domain-containing stress-associated protein

NCBI Description

Histone acetylation plays a key role in the regulation of eukaryotic gene expression. Histone acetylation and deacetylation are catalyzed by multisubunit complexes. The protein encoded by this gene is a component of the histone deacetylase complex, which includes SIN3, SAP30, HDAC1, HDAC2, RbAp46, RbAp48, and other polypeptides. This protein directly interacts with SIN3 and enhances SIN3-mediated transcriptional repression when tethered to the promoter. A pseudogene has been identified on chromosome 2. [provided by RefSeq, Dec 2008]