Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human SAFB Monoclonal Antibody | anti-SAFB antibody

SAFB (Scaffold Attachment Factor B1, SAF-B, SAF-B1, HSP27 Estrogen Response Element-TATA Box-binding Protein, HSP27 ERE-TATA-binding Protein, HAP, HET, SAFB1, DKFZp779C1727) (MaxLight 750)

Gene Names
SAFB; HAP; HET; SAFB1; SAF-B1
Reactivity
Human
Applications
Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
SAFB; Monoclonal Antibody; SAFB (Scaffold Attachment Factor B1; SAF-B; SAF-B1; HSP27 Estrogen Response Element-TATA Box-binding Protein; HSP27 ERE-TATA-binding Protein; HAP; HET; SAFB1; DKFZp779C1727) (MaxLight 750); anti-SAFB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5A11
Specificity
Recognizes human SAFB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-SAFB antibody
FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa111-201 from human SAFB (NP_002958) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DGQEDVETSLENLQDIDIMDISVLDEAEIDNGSVADCVEDDDADNLQESLSDSRELVEGEMKELPEQLQEHAIEDKETINNLDTSSSDFT*
Conjugate
MaxLight750
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Product Categories/Family for anti-SAFB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102,768 Da
NCBI Official Full Name
scaffold attachment factor B1 isoform 3
NCBI Official Synonym Full Names
scaffold attachment factor B
NCBI Official Symbol
SAFB
NCBI Official Synonym Symbols
HAP; HET; SAFB1; SAF-B1
NCBI Protein Information
scaffold attachment factor B1; HSP27 ERE-TATA-binding protein; HSP27 estrogen response element-TATA box-binding protein; Hsp27 ERE-TATA binding protein; SAB-B1; SAF-B; glutathione S-transferase fusion protein; heat-shock protein (HSP27) estrogen response
UniProt Protein Name
Scaffold attachment factor B1
UniProt Gene Name
SAFB
UniProt Synonym Gene Names
HAP; HET; SAFB1; SAF-B; SAF-B1; HSP27 ERE-TATA-binding protein

Uniprot Description

Binds to scaffold/matrix attachment region (S/MAR) DNA and forms a molecular assembly point to allow the formation of a 'transcriptosomal' complex (consisting of SR proteins and RNA polymerase II) coupling transcription and RNA processing (). Can function as an estrogen receptor corepressor and can also bind to the HSP27 promoter and decrease its transcription. When associated with RBMX, binds to and stimulates transcription from the SREBF1 promoter (). Can inhibit cell proliferation.

Similar Products

Product Notes

The SAFB safb (Catalog #AAA6235160) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The SAFB (Scaffold Attachment Factor B1, SAF-B, SAF-B1, HSP27 Estrogen Response Element-TATA Box-binding Protein, HSP27 ERE-TATA-binding Protein, HAP, HET, SAFB1, DKFZp779C1727) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SAFB can be used in a range of immunoassay formats including, but not limited to, FLISA, Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the SAFB safb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "SAFB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.