Mouse anti-Human S100A9 Monoclonal Antibody | anti-S100A9 antibody

S100A9 (S100 Calcium Binding Protein A9, 60B8AG, Calgranulin B, CAGB, Calprotectin L1H Subunit, CFAG, CGLB, Cystic Fibrosis Antigen, L1AG, Leukocyte L1 Complex Heavy Chain, LIAG, MAC387, Migration Inhibitory Factor-related Protein 14, MIF Related Protein

Cat. Num. AAA6154804

• Gene Names: S100A9; MIF; NIF; P14; CAGB; CFAG; CGLB; L1AG; LIAG; MRP14; 60B8AG; MAC387
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: S100A9; Monoclonal Antibody; S100A9 (S100 Calcium Binding Protein A9; 60B8AG; Calgranulin B; CAGB; Calprotectin L1H Subunit; CFAG; CGLB; Cystic Fibrosis Antigen; L1AG; Leukocyte L1 Complex Heavy Chain; LIAG; MAC387; Migration Inhibitory Factor-related Protein 14; MIF Related Protein; anti-S100A9 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4G9
• Specificity: Recognizes human S100A9.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 634

• Applicable Applications for anti-S100A9 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length recombinant corresponding to aa1-115 from human S100A9 (AAH47681) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENRNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.65kD).)

Western Blot (WB)

(S100A9 monoclonal antibody. Western Blot analysis of S100A9 expression in human kidney.)

Testing Data

(Detection limit for recombinant GST tagged S100A9 is 0.03ng/ml as a capture antibody.)

Related Product Information for anti-S100A9 antibody

S100 Calcium Binding Protein A9, also known as Calgranulin B, belongs to the S100 family containing EF-hand type Ca2+-binding proteins. It is involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation, and associated with the disease cystic fibrosis. S100A9 has been implicated in the abnormal differentiation of myeloid cells in the stroma of cancer. This protein may function in the inhibition of casein kinase.

Product Categories/Family for anti-S100A9 antibody

Antibodies; Binding Proteins; Calcium

NCBI and Uniprot Product Information

• NCBI GI #: 34783534
• NCBI GeneID: 6280
• NCBI Official Full Name: Homo sapiens S100 calcium binding protein A9, mRNA
• NCBI Official Synonym Full Names: S100 calcium binding protein A9
• NCBI Official Symbol: S100A9
• NCBI Official Synonym Symbols: MIF; NIF; P14; CAGB; CFAG; CGLB; L1AG; LIAG; MRP14; 60B8AG; MAC387
• NCBI Protein Information: protein S100-A9
• Protein Family: Protein

NCBI Description

The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity. [provided by RefSeq, Nov 2014]