Mouse anti-Human S100A13 Monoclonal Antibody | anti-S100A13 antibody

S100A13 (S100 Calcium-binding Protein A13, Protein S100-A13) (HRP)

Cat. Num. AAA6154796

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: S100A13; Monoclonal Antibody; S100A13 (S100 Calcium-binding Protein A13; Protein S100-A13) (HRP); anti-S100A13 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3A7
• Specificity: Recognizes human S100A13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 98

• Applicable Applications for anti-S100A13 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-99 from human S100A13 (NP_005970) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK*
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.89kD).)

Western Blot (WB)

(S100A13 monoclonal antibody, Western Blot analysis of S100A13 expression in MCF-7.)

Western Blot (WB)

(Western Blot analysis of S100A13 expression in transfected 293T cell line by S100A13 monoclonal antibody. Lane 1: S100A13 transfected lysate (11.5kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to S100A13 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged S100A13 is ~0.1ng/ml as a capture antibody.)

Related Product Information for anti-S100A13 antibody

S100A13, also known as S100 calcium binding protein A13, is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. It plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. S100A13 protein has been shown to interact with SYT1 and FGF1.

Product Categories/Family for anti-S100A13 antibody

Antibodies; Binding Proteins; Calcium

NCBI and Uniprot Product Information

• NCBI GI #: 5174659
• NCBI Accession #: NP_005970
• NCBI GenBank Nucleotide #: NM_005979
• UniProt Accession #: Q99584
• NCBI Official Full Name: protein S100-A13
• UniProt Protein Name: Protein S100-A13
• Protein Family: Protein
• UniProt Gene Name: S100A13
• UniProt Entry Name: S10AD_HUMAN

Uniprot Description

S100A13: Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine. Belongs to the S-100 family.

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: extracellular space; mast cell granule; perinuclear region of cytoplasm; cytoplasm; nucleus; cytosol

Molecular Function: protein binding; RAGE receptor binding; fibroblast growth factor binding; copper ion binding; protein homodimerization activity; zinc ion binding; calcium ion binding; lipid binding

Biological Process: regulation of cell shape; positive regulation of I-kappaB kinase/NF-kappaB cascade; response to copper ion; interleukin-1 alpha secretion; positive regulation of cell proliferation; mast cell degranulation; response to electrical stimulus; cytokine secretion