Mouse anti-Human RSL24D1 Monoclonal Antibody | anti-RSL24D1 antibody

RSL24D1 (C15orf15, Probable Ribosome Biogenesis Protein RLP24, Ribosomal L24 Domain-containing Protein 1, Ribosomal Protein L24-like, RPL24L, My024) (PE)

Cat. Num. AAA6160078

• Gene Names: RSL24D1; L30; RLP24; RPL24; TVAS3; RPL24L; C15orf15; HRP-L30-iso
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RSL24D1; Monoclonal Antibody; RSL24D1 (C15orf15; Probable Ribosome Biogenesis Protein RLP24; Ribosomal L24 Domain-containing Protein 1; Ribosomal Protein L24-like; RPL24L; My024) (PE); anti-RSL24D1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2A10-1E5
• Specificity: Recognizes human C15orf15.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 1396

• Applicable Applications for anti-RSL24D1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-151 from human C15orf15 (AAH05344) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MRIEKCYFCSGPIYPGHGMMFVRNDCKVFRFCKSKCHKNFKKKRNPRKVRWTKAFRKAAGKELTVDNSFEFEKRRNEPIKYQRELWNKTIDAMKRVEEIKQKRQAKFIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMV
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (42.61kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to C15orf15 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to C15orf15 on HeLa cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-RSL24D1 antibody

Antibodies; Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 13529145
• NCBI GeneID: 51187
• NCBI Official Full Name: Homo sapiens chromosome 15 open reading frame 15, mRNA
• NCBI Official Synonym Full Names: ribosomal L24 domain containing 1
• NCBI Official Symbol: RSL24D1
• NCBI Official Synonym Symbols: L30; RLP24; RPL24; TVAS3; RPL24L; C15orf15; HRP-L30-iso
• NCBI Protein Information: probable ribosome biogenesis protein RLP24

NCBI Description

This gene encodes a protein sharing a low level of sequence similarity with human ribosomal protein L24. Although this gene has been referred to as RPL24, L30, and 60S ribosomal protein L30 isolog in the sequence databases, it is distinct from the human genes officially named RPL24 (which itself has been referred to as ribosomal protein L30) and RPL30. The protein encoded by this gene localizes to the nucleolus and is thought to play a role in the biogenesis of the 60S ribosomal subunit. The precise function of this gene is currently unknown. This gene utilizes alternative polyadenylation signals and has multiple pseudogenes. [provided by RefSeq, Jul 2012]