Western Blot (WB)
(Western Blot detection against Immunogen (54.49kD).)
Mouse anti-Human RSG1 Monoclonal Antibody | anti-RSG1 antibody
RSG1 (C1orf89, REM2- and Rab-like Small GTPase 1, MGC10731) (AP)
Gene Names
CPLANE2; RSG1; C1orf89
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RSG1; Monoclonal Antibody; RSG1 (C1orf89; REM2- and Rab-like Small GTPase 1; MGC10731) (AP); anti-RSG1 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G4
Specificity
Recognizes human C1orf89.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RSG1 antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-259 from human C1orf89 (AAH02946) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MARPPVPGSVVVPNWHESAEGKEYLACILRKNRRRVFGLLERPVLLPPVSIDTASYKIFVSGKSGVGKTALVAKLAGLEVPVVHHGTTGIQTTVVFWPAKLQASSRVVMFRFEFWDCGESALKKFDHMLLACMENTDAFLFLFSFTDRASFEDLPGQLARIAGEAPGVVRMVIGSKFDQYMHTDVPERDLTAFRQAWELPLLRVKSVPGRRLADGRTLDGRAGLADVAHILNGLAEQLWHQDQVAAGLLPNPPESAPE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (54.49kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (54.49kD).)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to C1orf89 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)
Immunohistochemistry (IHC)
(Immunoperoxidase of monoclonal antibody to C1orf89 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)
Product Categories/Family for anti-RSG1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
28KD
NCBI Official Full Name
Homo sapiens chromosome 1 open reading frame 89, mRNA
NCBI Official Synonym Full Names
ciliogenesis and planar polarity effector 2
NCBI Official Symbol
CPLANE2
NCBI Official Synonym Symbols
RSG1; C1orf89
NCBI Protein Information
ciliogenesis and planar polarity effector 2
Protein Family
Similar Products
Product Notes
The RSG1 (Catalog #AAA6133559) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RSG1 (C1orf89, REM2- and Rab-like Small GTPase 1, MGC10731) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RSG1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RSG1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RSG1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
