Mouse anti-Human RPS7 Monoclonal Antibody

RPS7 (40S Ribosomal Protein S7)

Cat. Num. AAA6006097

• Reactivity: Human
• Applications: ELISA, Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Purified by Protein A affinity chromatography.
• Synonyms: RPS7; Monoclonal Antibody; RPS7 (40S Ribosomal Protein S7); Anti -RPS7 (40S Ribosomal Protein S7); anti-RPS7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3G4
• Specificity: Recognizes human RPS7. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.4.
• Sequence: IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL

• Applicable Applications for anti-RPS7 antibody: ELISA (EL/EIA), Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, ELISA, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 20ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Partial recombinant corresponding to aa95-195 from human RPS7 with GST tag. MW of the GST tag alone is 26kD.
• Grade: Affinity Purified
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RPS7 monoclonal antibody. Western Blot analysis of RPS7 expression in Raw 264.7 using MBS6006097.)

Western Blot (WB)

(RPS7 monoclonal antibody Western Blot analysis of RPS7 expression in NIH/3T3 using MBS6006097.)

Immunohistochemistry (IHC)

(Immunohistochemistry analysis of formalin-fiixed paraffin-embedded human placenta using MBS6006097 (3ug/ml))

Immunofluorescence (IF)

(Immunofluorescence analysis of RPS7 in HeLa cell using MBS6006097 (20ug/ml).)

Testing Data

(Detection limit for recombinant GST tagged RPS7 is ~1ng/ml using MBS6006097 as a capture antibody.)

Related Product Information for anti-RPS7 antibody

The peptide is used to block anti-aurora A (pT288) Antibiody (MBS8233113) reactivity

Product Categories/Family for anti-RPS7 antibody

Antibodies; Abs to Ribosomal Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 525312520
• Molecular Weight: ndfkjnksdfjbnkjfs
• NCBI Official Full Name: rps7 (chloroplast)
• Protein Family: Ribosomal protein

Uniprot Description

One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit.