Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RPS7 monoclonal antibody Western Blot analysis of RPS7 expression in HeLa.)

Mouse RPS7 Monoclonal Antibody | anti-RPS7 antibody

RPS7 (40S Ribosomal Protein S7) (AP)

Gene Names
RPS7; S7; DBA8
Reactivity
Human, Mouse, Rat
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RPS7; Monoclonal Antibody; RPS7 (40S Ribosomal Protein S7) (AP); anti-RPS7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
3G4
Specificity
Recognizes human RPS7. Species Crossreactivity: mouse and rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-RPS7 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa95-195 from human RPS7 (NP_001002) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IAQRRILPKPTRKSRTKNKQKRPRSRTLTAVHDAILEDLVFPSEIVGKRIRVKLDGSRLIKVHLDKAQQNNVEHKVETFSGVYKKLTGKDVNFEFPEFQL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(RPS7 monoclonal antibody Western Blot analysis of RPS7 expression in HeLa.)

Western Blot (WB) (RPS7 monoclonal antibody Western Blot analysis of RPS7 expression in HeLa.)

Western Blot (WB)

(RPS7 monoclonal antibody. Western Blot analysis of RPS7 expression in PC-12.)

Western Blot (WB) (RPS7 monoclonal antibody. Western Blot analysis of RPS7 expression in PC-12.)

Western Blot (WB)

(RPS7 monoclonal antibody. Western Blot analysis of RPS7 expression in Raw 264.7.)

Western Blot (WB) (RPS7 monoclonal antibody. Western Blot analysis of RPS7 expression in Raw 264.7.)

Western Blot (WB)

(RPS7 monoclonal antibody Western Blot analysis of RPS7 expression in NIH/3T3.)

Western Blot (WB) (RPS7 monoclonal antibody Western Blot analysis of RPS7 expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to RPS7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to RPS7 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to RPS7 on HeLa cell. [antibody concentration 20ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to RPS7 on HeLa cell. [antibody concentration 20ug/ml])

Testing Data

(Detection limit for recombinant GST tagged RPS7 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RPS7 is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-RPS7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24.7 kDa (218aa), confirmed by MALDI-TOF
NCBI Official Full Name
40S ribosomal protein S7
NCBI Official Synonym Full Names
ribosomal protein S7
NCBI Official Symbol
RPS7
NCBI Official Synonym Symbols
S7; DBA8
NCBI Protein Information
40S ribosomal protein S7
UniProt Protein Name
40S ribosomal protein S7
Protein Family
UniProt Gene Name
RPS7
UniProt Entry Name
RS7_HUMAN

NCBI Description

Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 40S subunit. The protein belongs to the S7E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. [provided by RefSeq, Jul 2008]

Uniprot Description

RPS7: Required for rRNA maturation. Defects in RPS7 are the cause of Diamond-Blackfan anemia type 8 (DBA8). DBA8 is a form of Diamond-Blackfan anemia, a congenital non-regenerative hypoplastic anemia that usually presents early in infancy. Diamond-Blackfan anemia is characterized by a moderate to severe macrocytic anemia, erythroblastopenia, and an increased risk of malignancy. 30 to 40% of Diamond-Blackfan anemia patients present with short stature and congenital anomalies, the most frequent being craniofacial (Pierre-Robin syndrome and cleft palate), thumb and urogenital anomalies. Belongs to the ribosomal protein S7e family.

Protein type: Ribosomal; Translation

Chromosomal Location of Human Ortholog: 2p25

Cellular Component: small subunit processome; focal adhesion; membrane; cytoplasm; nucleolus; ribosome; microtubule organizing center; ribonucleoprotein complex; nucleus; cytosol

Molecular Function: protein binding; structural constituent of ribosome; RNA binding

Biological Process: SRP-dependent cotranslational protein targeting to membrane; translation; viral reproduction; viral infectious cycle; translational termination; ribosomal small subunit biogenesis and assembly; translational elongation; cellular protein metabolic process; translational initiation; mRNA catabolic process, nonsense-mediated decay; gene expression; viral transcription; rRNA processing

Disease: Diamond-blackfan Anemia 8

Research Articles on RPS7

Similar Products

Product Notes

The RPS7 rps7 (Catalog #AAA6133547) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPS7 (40S Ribosomal Protein S7) (AP) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RPS7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPS7 rps7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPS7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.