Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (RPS6KA6 monoclonal antibody (M07), clone 8D2 Western Blot analysis of RPS6KA6 expression in PC-12 (Cat # L012V1).)

Mouse RPS6KA6 Monoclonal Antibody | anti-RPS6KA6 antibody

RPS6KA6 (Ribosomal Protein S6 Kinase, 90kD, Polypeptide 6, RSK4) (FITC)

Gene Names
RPS6KA6; RSK4; PP90RSK4
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
RPS6KA6; Monoclonal Antibody; RPS6KA6 (Ribosomal Protein S6 Kinase; 90kD; Polypeptide 6; RSK4) (FITC); Ribosomal Protein S6 Kinase; RSK4; anti-RPS6KA6 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
8D2
Specificity
Recognizes RPS6KA6.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-RPS6KA6 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RPS6KA6 (NP_055311.1, 636aa-745aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(RPS6KA6 monoclonal antibody (M07), clone 8D2 Western Blot analysis of RPS6KA6 expression in PC-12 (Cat # L012V1).)

Western Blot (WB) (RPS6KA6 monoclonal antibody (M07), clone 8D2 Western Blot analysis of RPS6KA6 expression in PC-12 (Cat # L012V1).)
Related Product Information for anti-RPS6KA6 antibody
Mouse monoclonal antibody raised against a partial recombinant RPS6KA6.
Product Categories/Family for anti-RPS6KA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83,872 Da
NCBI Official Full Name
ribosomal protein S6 kinase alpha-6
NCBI Official Synonym Full Names
ribosomal protein S6 kinase, 90kDa, polypeptide 6
NCBI Official Symbol
RPS6KA6
NCBI Official Synonym Symbols
RSK4; PP90RSK4
NCBI Protein Information
ribosomal protein S6 kinase alpha-6; RSK-4; p90RSK6; p90-RSK 6; S6K-alpha 6; S6K-alpha-6; ribosomal S6 kinase 4; 90 kDa ribosomal protein S6 kinase 6
UniProt Protein Name
Ribosomal protein S6 kinase alpha-6
UniProt Gene Name
RPS6KA6
UniProt Synonym Gene Names
RSK4; S6K-alpha-6; p90-RSK 6; p90RSK6; RSK-4
UniProt Entry Name
KS6A6_HUMAN

NCBI Description

This gene encodes a member of ribosomal S6 kinase family, serine-threonine protein kinases which are regulated by growth factors. The encoded protein may be distinct from other members of this family, however, as studies suggest it is not growth factor dependent and may not participate in the same signaling pathways. [provided by RefSeq, Jan 2010]

Uniprot Description

RSK4: an AGC kinase of the RSK family. Phosphorylates a wide range of substrates including ribosomal protein S6. Implicated in the activation of the mitogen- activated kinase cascade. May play a role in normal neuronal development.

Protein type: Protein kinase, AGC; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; EC 2.7.11.1; AGC group; RSK family; RSK subfamily

Chromosomal Location of Human Ortholog: Xq21

Cellular Component: nucleoplasm; mitochondrion; nucleolus; nucleus; cytosol

Molecular Function: protein serine/threonine kinase activity; magnesium ion binding; ATP binding; protein kinase activity

Biological Process: axon guidance; synaptic transmission; negative regulation of embryonic development; DNA damage response, signal transduction by p53 class mediator resulting in transcription of p21 class mediator; central nervous system development; signal transduction; protein amino acid phosphorylation

Research Articles on RPS6KA6

Similar Products

Product Notes

The RPS6KA6 rps6ka6 (Catalog #AAA6176062) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RPS6KA6 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RPS6KA6 rps6ka6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RPS6KA6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.