Western Blot (WB)
(Western Blot detection against Immunogen (34.36kD).)
Mouse anti-Human RPP14 Monoclonal Antibody | anti-RPP14 antibody
RPP14 (Ribonuclease P Protein Subunit p14, P14)
Gene Names
RPP14; P14
Reactivity
Human
Applications
ELISA, Western Blot
Purity
AscitesAscites
Synonyms
RPP14; Monoclonal Antibody; RPP14 (Ribonuclease P Protein Subunit p14; P14); Anti -RPP14 (Ribonuclease P Protein Subunit p14; anti-RPP14 antibody
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H4
Specificity
Recognizes human RPP14.
Purity/Purification
Ascites
Ascites
Ascites
Form/Format
Supplied as a liquid in ascites fluid.
Sequence
MPAPAATYERVVYKNPSEYHYMKVCLEFQDCGVGLNAAQFKQLLISAVKDLFGEVDAALPLDILTYEEKTLSAIL
Applicable Applications for anti-RPP14 antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa1-76 from human RPP14 (NP_008973) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot detection against Immunogen (34.36kD).)
Western Blot (WB)
(Western Blot detection against Immunogen (34.36kD).)
Product Categories/Family for anti-RPP14 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
13,693 Da
NCBI Official Full Name
ribonuclease P protein subunit p14
NCBI Official Synonym Full Names
ribonuclease P/MRP 14kDa subunit
NCBI Official Symbol
RPP14
NCBI Official Synonym Symbols
P14
NCBI Protein Information
ribonuclease P protein subunit p14
UniProt Protein Name
Ribonuclease P protein subunit p14
Protein Family
UniProt Gene Name
RPP14
UniProt Entry Name
RPP14_HUMAN
Uniprot Description
RPP14: Part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Belongs to the eukaryotic/archaeal RNase P protein component 2 family.
Protein type: Ribonuclease; EC 3.1.26.5
Chromosomal Location of Human Ortholog: 3p14.3
Cellular Component: nucleus
Molecular Function: RNA binding; ribonuclease P activity
Biological Process: tRNA processing
Research Articles on RPP14
Similar Products
Product Notes
The RPP14 rpp14 (Catalog #AAA6006811) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RPP14 (Ribonuclease P Protein Subunit p14, P14) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RPP14 can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the RPP14 rpp14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPAPAATYER VVYKNPSEYH YMKVCLEFQD CGVGLNAAQF KQLLISAVKD LFGEVDAALP LDILTYEEKT LSAIL. It is sometimes possible for the material contained within the vial of "RPP14, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
