Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RORB is approximately 0.1ng/ml as a capture antibody.)

Mouse RORB Monoclonal Antibody | anti-RORB antibody

RORB (RAR-Related Orphan Receptor B, NR1F2, ROR-BETA, RZR-BETA, RZRB, bA133M9.1) (Biotin)

Gene Names
RORB; RZRB; NR1F2; ROR-BETA; RZR-BETA; bA133M9.1
Applications
Western Blot
Purity
Purified
Synonyms
RORB; Monoclonal Antibody; RORB (RAR-Related Orphan Receptor B; NR1F2; ROR-BETA; RZR-BETA; RZRB; bA133M9.1) (Biotin); RAR-Related Orphan Receptor B; bA133M9.1; anti-RORB antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1, lambda
Clone Number
1D1
Specificity
Recognizes RORB.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-RORB antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
RORB (NP_008845, 136aa-224aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFNNGQLAPGITMTEIDRIAQNIIKSHL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RORB is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RORB is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-RORB antibody
The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It is a DNA-binding protein that can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation. [provided by RefSeq]
Product Categories/Family for anti-RORB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52,073 Da
NCBI Official Full Name
nuclear receptor ROR-beta
NCBI Official Synonym Full Names
RAR-related orphan receptor B
NCBI Official Symbol
RORB
NCBI Official Synonym Symbols
RZRB; NR1F2; ROR-BETA; RZR-BETA; bA133M9.1
NCBI Protein Information
nuclear receptor ROR-beta; RAR-related orphan receptor beta; nuclear receptor RZR-beta; nuclear receptor subfamily 1 group F member 2; retinoic acid-binding receptor beta; retinoid-related orphan receptor beta; retinoid-related orphan receptor-beta
UniProt Protein Name
Nuclear receptor ROR-beta
Protein Family
UniProt Gene Name
RORB
UniProt Synonym Gene Names
NR1F2; RZRB
UniProt Entry Name
RORB_HUMAN

Uniprot Description

RORB: Orphan nuclear receptor required for normal postnatal development of rod and cone photoreceptor cells. Regulates transcription of OPN1SW in cone photoreceptor cells by binding the sequence 5'-AGGTCA-3' in the OPN1SW promoter. Belongs to the nuclear hormone receptor family. NR1 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Nuclear receptor

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: nucleoplasm; nucleus

Molecular Function: ligand-dependent nuclear receptor activity; protein binding; zinc ion binding; sequence-specific DNA binding; steroid hormone receptor activity; transcription factor activity; transcription factor binding

Biological Process: transcription initiation from RNA polymerase II promoter; intracellular receptor-mediated signaling pathway; retinal rod cell development; positive regulation of transcription, DNA-dependent; rhythmic process; regulation of circadian rhythm; eye photoreceptor cell development; retinal cone cell development; visual perception; regulation of transcription, DNA-dependent; retina development in camera-type eye; gene expression; steroid hormone mediated signaling; negative regulation of osteoblast differentiation; negative regulation of transcription, DNA-dependent

Similar Products

Product Notes

The RORB rorb (Catalog #AAA6171243) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's RORB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RORB rorb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RORB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.