Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged RORA is ~0.3ng/ml as a capture antibody.)

Mouse anti-Human ROR alpha Monoclonal Antibody | anti-RORA antibody

ROR alpha (Nuclear Receptor ROR-alpha, Retinoid-related Orphan Receptor-alpha, Nuclear Receptor RZR-alpha, Nuclear Receptor Subfamily 1 Group F Member 1, NR1F1, RZRA, RORA) (HRP)

Gene Names
RORA; ROR1; ROR2; ROR3; RZRA; NR1F1; IDDECA; RZR-ALPHA
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ROR alpha; Monoclonal Antibody; ROR alpha (Nuclear Receptor ROR-alpha; Retinoid-related Orphan Receptor-alpha; Nuclear Receptor RZR-alpha; Nuclear Receptor Subfamily 1 Group F Member 1; NR1F1; RZRA; RORA) (HRP); anti-RORA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Clone Number
4E3
Specificity
Recognizes human RORA.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-RORA antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa424-524, from human RORA (NP_599023) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RORA is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged RORA is ~0.3ng/ml as a capture antibody.)
Related Product Information for anti-RORA antibody
RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.
Product Categories/Family for anti-RORA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
nuclear receptor ROR-alpha isoform a
NCBI Official Synonym Full Names
RAR related orphan receptor A
NCBI Official Symbol
RORA
NCBI Official Synonym Symbols
ROR1; ROR2; ROR3; RZRA; NR1F1; IDDECA; RZR-ALPHA
NCBI Protein Information
nuclear receptor ROR-alpha
Protein Family

NCBI Description

The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2014]

Research Articles on RORA

Similar Products

Product Notes

The RORA (Catalog #AAA6154708) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ROR alpha (Nuclear Receptor ROR-alpha, Retinoid-related Orphan Receptor-alpha, Nuclear Receptor RZR-alpha, Nuclear Receptor Subfamily 1 Group F Member 1, NR1F1, RZRA, RORA) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ROR alpha can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RORA for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ROR alpha, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.