Mouse anti-Human ROR alpha Monoclonal Antibody | anti-RORA antibody

ROR alpha (Nuclear Receptor ROR-alpha, Retinoid-related Orphan Receptor-alpha, Nuclear Receptor RZR-alpha, Nuclear Receptor Subfamily 1 Group F Member 1, NR1F1, RZRA, RORA) (FITC)

Cat. Num. AAA6149405

• Gene Names: RORA; ROR1; ROR2; ROR3; RZRA; NR1F1; IDDECA; RZR-ALPHA
• Reactivity: Human
• Applications: ELISA
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ROR alpha; Monoclonal Antibody; ROR alpha (Nuclear Receptor ROR-alpha; Retinoid-related Orphan Receptor-alpha; Nuclear Receptor RZR-alpha; Nuclear Receptor Subfamily 1 Group F Member 1; NR1F1; RZRA; RORA) (FITC); anti-RORA antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG
• Clone Number: 4E3
• Specificity: Recognizes human RORA.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-RORA antibody: ELISA (EIA)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa424-524, from human RORA (NP_599023) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SAFVLMSADRSWLQEKVKIEKLQQKIQLALQHVLQKNHREDGILTKLICKVSTLRALCGRHTEKLMAFKAIYPDIVRLHFPPLYKELFTSEFEPAMQIDG
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged RORA is ~0.3ng/ml as a capture antibody.)

Related Product Information for anti-RORA antibody

RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.

Product Categories/Family for anti-RORA antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 19743903
• NCBI GeneID: 6095
• NCBI Accession #: NP_599023
• NCBI GenBank Nucleotide #: NM_134261
• UniProt Accession #: B6ZGS4; P35398
• Molecular Weight: 59kDa
• NCBI Official Full Name: nuclear receptor ROR-alpha isoform a
• NCBI Official Synonym Full Names: RAR related orphan receptor A
• NCBI Official Symbol: RORA
• NCBI Official Synonym Symbols: ROR1; ROR2; ROR3; RZRA; NR1F1; IDDECA; RZR-ALPHA
• NCBI Protein Information: nuclear receptor ROR-alpha
• Protein Family: Nuclear receptor

NCBI Description

The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptional regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2014]