Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged ROBO2 is ~1ng/ml as a capture antibody.)

Mouse anti-Human ROBO2 Monoclonal Antibody | anti-ROBO2 antibody

ROBO2 (Roundabout Homolog 2, KIAA1568) (PE)

Gene Names
ROBO2; SAX3
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ROBO2; Monoclonal Antibody; ROBO2 (Roundabout Homolog 2; KIAA1568) (PE); anti-ROBO2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4G5
Specificity
Recognizes human ROBO2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-ROBO2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa441-541, from human ROBO2 (NP_002933) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTL
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ROBO2 is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged ROBO2 is ~1ng/ml as a capture antibody.)
Related Product Information for anti-ROBO2 antibody
Structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair.
Product Categories/Family for anti-ROBO2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
151kDa
NCBI Official Full Name
roundabout homolog 2 isoform ROBO2b
NCBI Official Synonym Full Names
roundabout guidance receptor 2
NCBI Official Symbol
ROBO2
NCBI Official Synonym Symbols
SAX3
NCBI Protein Information
roundabout homolog 2
UniProt Protein Name
Roundabout homolog 2
Protein Family
UniProt Gene Name
ROBO2
UniProt Synonym Gene Names
KIAA1568
UniProt Entry Name
ROBO2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the ROBO family, part of the immunoglobulin superfamily of proteins that are highly conserved from fly to human. The encoded protein is a transmembrane receptor for the slit homolog 2 protein and functions in axon guidance and cell migration. Mutations in this gene are associated with vesicoureteral reflux, characterized by the backward flow of urine from the bladder into the ureters or the kidney. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Uniprot Description

ROBO2: Receptor for SLIT2, and probably SLIT1, which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development. Defects in ROBO2 are the cause of vesicoureteral reflux type 2 (VUR2). VUR is a complex, genetically heterogeneous developmental disorder characterized by the retrograde flow of urine from the bladder into the ureter and is associated with reflux nephropathy, the cause of 15% of end-stage renal disease in children and young adults. A chromosomal aberration involving ROBO2 is a cause of multiple congenital abnormalities, including severe bilateral VUR with ureterovesical junction defects. Translocation t(Y;3)(p11;p12) with PCDH11Y. This translocation disrupts ROBO2 and produces dominant-negative ROBO2 proteins that abrogate SLIT- ROBO signaling in vitro. Belongs to the immunoglobulin superfamily. ROBO family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell adhesion; Motility/polarity/chemotaxis; Cell development/differentiation

Chromosomal Location of Human Ortholog: 3p12.3

Cellular Component: cell surface; integral to membrane; axolemma

Molecular Function: identical protein binding; protein binding; axon guidance receptor activity

Biological Process: axon guidance; central nervous system development; olfactory bulb interneuron development; negative regulation of synaptogenesis; axon midline choice point recognition; cellular response to hormone stimulus; negative regulation of negative chemotaxis; ureteric bud development; positive regulation of axonogenesis; brain development; homophilic cell adhesion; metanephros development; retinal ganglion cell axon guidance

Disease: Vesicoureteral Reflux 2

Research Articles on ROBO2

Similar Products

Product Notes

The ROBO2 robo2 (Catalog #AAA6160004) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ROBO2 (Roundabout Homolog 2, KIAA1568) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ROBO2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ROBO2 robo2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ROBO2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.