Mouse anti-Human ROBO2 Monoclonal Antibody | anti-ROBO2 antibody

ROBO2 (Roundabout Homolog 2, KIAA1568) (FITC)

Cat. Num. AAA6149398

• Gene Names: ROBO2; SAX3
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ROBO2; Monoclonal Antibody; ROBO2 (Roundabout Homolog 2; KIAA1568) (FITC); anti-ROBO2 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4G5
• Specificity: Recognizes human ROBO2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-ROBO2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa441-541, from human ROBO2 (NP_002933) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: ATGDPLPVISWLKEGFTFPGRDPRATIQEQGTLQIKNLRISDTGTYTCVATSSSGETSWSAVLDVTESGATISKNYDLSDLPGPPSKPQVTDVTKNSVTL
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged ROBO2 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-ROBO2 antibody

Structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair.

Product Categories/Family for anti-ROBO2 antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 61888896
• NCBI GeneID: 6092
• NCBI Accession #: NP_002933
• NCBI GenBank Nucleotide #: NM_002942
• UniProt Accession #: Q9HCK4
• Molecular Weight: 151kDa
• NCBI Official Full Name: roundabout homolog 2 isoform ROBO2b
• NCBI Official Synonym Full Names: roundabout guidance receptor 2
• NCBI Official Symbol: ROBO2
• NCBI Official Synonym Symbols: SAX3
• NCBI Protein Information: roundabout homolog 2
• UniProt Protein Name: Roundabout homolog 2
• Protein Family: Roundabout
• UniProt Gene Name: ROBO2
• UniProt Synonym Gene Names: KIAA1568
• UniProt Entry Name: ROBO2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the ROBO family, part of the immunoglobulin superfamily of proteins that are highly conserved from fly to human. The encoded protein is a transmembrane receptor for the slit homolog 2 protein and functions in axon guidance and cell migration. Mutations in this gene are associated with vesicoureteral reflux, characterized by the backward flow of urine from the bladder into the ureters or the kidney. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2014]

Uniprot Description

ROBO2: Receptor for SLIT2, and probably SLIT1, which are thought to act as molecular guidance cue in cellular migration, including axonal navigation at the ventral midline of the neural tube and projection of axons to different regions during neuronal development. Defects in ROBO2 are the cause of vesicoureteral reflux type 2 (VUR2). VUR is a complex, genetically heterogeneous developmental disorder characterized by the retrograde flow of urine from the bladder into the ureter and is associated with reflux nephropathy, the cause of 15% of end-stage renal disease in children and young adults. A chromosomal aberration involving ROBO2 is a cause of multiple congenital abnormalities, including severe bilateral VUR with ureterovesical junction defects. Translocation t(Y;3)(p11;p12) with PCDH11Y. This translocation disrupts ROBO2 and produces dominant-negative ROBO2 proteins that abrogate SLIT- ROBO signaling in vitro. Belongs to the immunoglobulin superfamily. ROBO family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Cell adhesion; Motility/polarity/chemotaxis; Cell development/differentiation

Chromosomal Location of Human Ortholog: 3p12.3

Cellular Component: cell surface; integral to membrane; axolemma

Molecular Function: identical protein binding; protein binding; axon guidance receptor activity

Biological Process: axon guidance; central nervous system development; olfactory bulb interneuron development; negative regulation of synaptogenesis; axon midline choice point recognition; cellular response to hormone stimulus; negative regulation of negative chemotaxis; ureteric bud development; positive regulation of axonogenesis; brain development; homophilic cell adhesion; metanephros development; retinal ganglion cell axon guidance

Disease: Vesicoureteral Reflux 2