Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human RNFT1 Monoclonal Antibody | anti-RNFT1 antibody

RNFT1 (LOC51136, RING Finger and Transmembrane Domain-containing Protein 1, Protein PTD016, PTD016, MGC111090) (PE)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
RNFT1; Monoclonal Antibody; RNFT1 (LOC51136; RING Finger and Transmembrane Domain-containing Protein 1; Protein PTD016; PTD016; MGC111090) (PE); anti-RNFT1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4H7
Specificity
Recognizes human LOC51136.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
435
Applicable Applications for anti-RNFT1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-101 from human LOC51136 (NP_057209) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MQANRSQLHSPPGTGSSEDASTPQCVHTRLTGEGSCPHSGDVHIQINSIPKECAENASSRNIRSGVHSCAHGCVHSRLRGHSHSEARLTDDTAAESGDHG
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of LOC51136 expression in transfected 293T cell line by LOC51136 monoclonal antibody. Lane 1: LOC51136 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of LOC51136 expression in transfected 293T cell line by LOC51136 monoclonal antibody. Lane 1: LOC51136 transfected lysate (23.2kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-RNFT1 antibody
PTD016 contains a RING-type zinc finger. The function of this protein is unknown.
Product Categories/Family for anti-RNFT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
E3 ubiquitin-protein ligase RNFT1
UniProt Protein Name
RING finger and transmembrane domain-containing protein 1
UniProt Gene Name
RNFT1
UniProt Entry Name
RNFT1_HUMAN

Uniprot Description

Subcellular location: Membrane; Multi-pass membrane protein

Potential.

Tissue specificity: Expressed at highest levels in testis, lower levels in heart, liver, lung, and kidney. Not detected in brain, ovary, and uterus. Down-regulated in testis from patients with maturation arrest (MA) or Sertoli cell-only syndrome (SCOS). Ref.6

Sequence similarities: Contains 1 RING-type zinc finger.

Sequence caution: The sequence AAD43009.1 differs from that shown. Reason: Frameshift at positions 150 and 167. The sequence BAC05364.1 differs from that shown. Reason: Erroneous initiation. Isoform 2: The sequence AAD43009.1 differs from that shown. Reason: Frameshift at position 199.

Similar Products

Product Notes

The RNFT1 rnft1 (Catalog #AAA6158645) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The RNFT1 (LOC51136, RING Finger and Transmembrane Domain-containing Protein 1, Protein PTD016, PTD016, MGC111090) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RNFT1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the RNFT1 rnft1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RNFT1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.