Mouse anti-Human RNF217 Monoclonal Antibody | anti-RNF217 antibody

RNF217 (C6orf172, IBRDC1, Probable E3 Ubiquitin-protein Ligase RNF217, IBR Domain-containing Protein 1, RING Finger Protein 217, MGC26996, DJ84N20.1) (AP)

Cat. Num. AAA6131789

• Gene Names: RNF217; OSTL; IBRDC1; C6orf172; dJ84N20.1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: RNF217; Monoclonal Antibody; RNF217 (C6orf172; IBRDC1; Probable E3 Ubiquitin-protein Ligase RNF217; IBR Domain-containing Protein 1; RING Finger Protein 217; MGC26996; DJ84N20.1) (AP); anti-RNF217 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4B1
• Specificity: Recognizes human IBRDC1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-RNF217 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant protein corresponding to aa2-101 from human IBRDC1 (NP_689766) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHE
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(IBRDC1 monoclonal antibody, Western Blot analysis of IBRDC1 expression in HepG2.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to IBRDC1 on HepG2 cell. [antibody concentration 10ug/ml].)

Product Categories/Family for anti-RNF217 antibody

Antibodies; Transcription Factors; Zinc (Ring) Finger

NCBI and Uniprot Product Information

• NCBI GI #: 22749145
• NCBI GeneID: 154214
• NCBI Accession #: NP_689766
• NCBI GenBank Nucleotide #: NM_152553
• UniProt Accession #: Q8TC41
• Molecular Weight: 30kDa
• NCBI Official Full Name: probable E3 ubiquitin-protein ligase RNF217 isoform b
• NCBI Official Synonym Full Names: ring finger protein 217
• NCBI Official Symbol: RNF217
• NCBI Official Synonym Symbols: OSTL; IBRDC1; C6orf172; dJ84N20.1
• NCBI Protein Information: probable E3 ubiquitin-protein ligase RNF217
• UniProt Protein Name: Probable E3 ubiquitin-protein ligase RNF217
• Protein Family: Probable E3 ubiquitin-protein ligase
• UniProt Gene Name: RNF217
• UniProt Synonym Gene Names: C6orf172; IBRDC1

NCBI Description

This protein encoded by this gene is a member of the RING1-IBR-RING24 (RBR) ubiquitin protein ligase family, and it belongs to a subfamily of these proteins that contain a transmembrane domain. This protein can interact with the HAX1 anti-apoptotic protein via its C-terminal RING finger motif, which suggests a role in apoptosis signaling. It is thought that deregulation of this gene can be a mechanism in leukemogenesis. Mutations in the region encoding the protein GXXXG motif, which appears to be necessary for protein self-association, have been found in human cancers. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Apr 2016]

Uniprot Description

RNF217: E3 ubiquitin-protein ligase which accepts ubiquitin from E2 ubiquitin-conjugating enzymes in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. Belongs to the RBR family. RNF217 subfamily.

Protein type: EC 6.3.2.-; EC 6.3.2.19; Ligase; Membrane protein, integral; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 6q22.31

Cellular Component: cytoplasm; cytosol; integral component of membrane; ubiquitin ligase complex

Molecular Function: metal ion binding; ubiquitin conjugating enzyme binding; ubiquitin-protein transferase activity

Biological Process: positive regulation of proteasomal ubiquitin-dependent protein catabolic process; protein polyubiquitination; protein ubiquitination involved in ubiquitin-dependent protein catabolic process